KEGG   Mycobacterium tuberculosis H37Rv: Rv3162cHelp
Entry
Rv3162c           CDS       T00015                                 

Definition
(RefSeq) integral membrane protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 888756
NCBI-ProteinID: NP_217678
TubercuList: Rv3162c
UniProt: O53312 A0A089QQL6
Position
complement(3531208..3531645)
Genome map
AA seq 145 aa AA seqDB search
MTSFAHPGTRGLSTVFGLMMVGSAAVGSHGLAVVVGLAAVIAVGVAAVFRLAATLAVVLS
VVMIVVSGPTHVLAALSGFCAAVYLVCRYGAGVVAGSWPTTVAAVGFTFAGLAATSFPLQ
VPWLPLAAPLAVLATYVLATRPFSR
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgtttgcgcacccgggtactcgtgggctctccacggtgttcggactgatgatg
gtggggtcggccgctgtgggatcgcacgggctggctgttgtcgtggggcttgccgcggtg
attgcggtaggggtggcggcggtgtttcgcctggcggcaacgcttgccgtggtgttgtcg
gtggtgatgatcgtggtgtccggcccgacgcatgtgcttgccgcattgtcggggttttgc
gccgccgtctacctggtgtgccgatacggggccggtgttgtcgccgggagctggccgacg
accgttgccgccgttggtttcacgttcgctgggttggctgcgacgtcgttcccgctgcaa
gtgccatggctgccgttggcggcaccgttggccgtgttggctacctacgtgctggccacc
cgtccgttctcgaggtga

DBGET integrated database retrieval system