KEGG   Mycobacterium tuberculosis H37Rv: Rv3164cHelp
Entry
Rv3164c           CDS       T00015                                 

Gene name
moxR3
Definition
(RefSeq) methanol dehydrogenase transcriptional regulator MoxR
  KO
K03924  MoxR-like ATPase [EC:3.6.3.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rv3164c (moxR3)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Rv3164c (moxR3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_3 AAA_5 Sigma54_activat RuvB_N AAA MCM Mg_chelatase
Motif
Other DBs
NCBI-GeneID: 887658
NCBI-ProteinID: NP_217680
TubercuList: Rv3164c
UniProt: O53314 L0TEH1
Position
complement(3532943..3533905)
Genome map
AA seq 320 aa AA seqDB search
MIMPAATTTAHCEAVLDEIERVVVGKRSALTLILTAVLARGHVLIEDLPGLGKTLIARSF
AAALGLDFTRVQFTPDLLPADLLGSTIYDMQSGRFEFRAGPIFTNLLLADEINRTPPKTQ
AALLEAMAEGQVSIDGQTHKLAMPFIVLATDNPIEYEGTYPLPEAQLDRFAIRLELRYLS
ERDETSMLRRRLERGSADPTVNQVVDCHDLLAMRESVEQVTVHEDVLHYVVSLANATRHH
PQVAVGASPRAELDLVQLSRARALLLGRDYVIPEDVKELATAAVAHRITLRPEMWVRKIA
GADVVSELLRRLPVPRISGT
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattatgccggccgcgacgaccaccgcccactgcgaggcggtgctcgacgaaatcgaa
cgtgtggtggtggggaagcgctctgcactgacactcatcctcaccgccgtgctcgcccgt
ggccacgtgctcatcgaagatctccccggcctcggcaagacgctgatcgcgcgatccttc
gccgccgcgttggggctcgatttcacccgagtgcaattcacgcctgatttgctgccggcc
gatctgctcggctcgaccatctatgacatgcagtccggtcgtttcgaattccgggccggg
cctattttcaccaacctgttgctcgccgacgagatcaaccggacgccgccgaagacgcaa
gcggcactgttggaggcaatggccgagggccaggtgagcatcgatggccaaacccataaa
ctggcaatgccattcatcgttctggcgaccgacaatccgatcgaatacgagggcacatat
ccactgccggaggcgcaactggatcggttcgcgatccggttggaactgcgctacctctcc
gagcgagacgagacctcgatgctgcgccgtcgcctggaacgcggttctgcggatccgacg
gtgaatcaggtggtggactgccacgatctgttggccatgcgtgaatcggtcgagcaggtc
accgtgcacgaggacgtcttgcactatgtggtgtcgttggccaacgctacccggcaccat
ccgcaggtggccgtcggcgccagcccgcgagccgaactcgacctggtccagctctcccgt
gcccgcgctctgttgctcggccgggactacgtcatacccgaagatgtcaaggaacttgcg
accgcggccgtcgcgcatcggatcacattgcgcccggagatgtgggtgcgcaagattgcg
ggcgctgatgtggtctcagagctgttgcggcgtctgcctgttccccgaattagtggaacg
tag

DBGET integrated database retrieval system