KEGG   Mycobacterium tuberculosis H37Rv: Rv3166cHelp
Entry
Rv3166c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4129 DUF1345 LPG_synthase_TM
Motif
Other DBs
NCBI-GeneID: 888750
NCBI-ProteinID: NP_217682
TubercuList: Rv3166c
UniProt: A0A089QUC7 O53316
Position
complement(3534392..3535351)
Genome map
AA seq 319 aa AA seqDB search
MPGTKPGSDKPTGRVVVVIVLLMLAGAALRGHLPADDGAPLAAAGGSRAALMFIVAALAA
TLALIALAIITRLRHPLPVAPSAGELSAMLGGAAGRPNWRVLLLGLGTILAWLLIAILLA
RLFVPDDVGPAAPIPDSTATPDASSTTPSRPQPPQDNNDDVLGILFASTIGLFLMVVAGS
LITSRRQRKSAPARISGDRIESPAPSARSESLARAAEIGLAEMADLRREPREAIIACYVA
MERELSHVPGVAPQDFDTPTEVLARAVEHRALHGASAAALVSLFAEARFSPHVMNEEHRE
VAMRLLRLVLDELSTRTAI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtactaagcccggtagtgacaaaccgacagggcgcgtcgtcgtcgtgatcgtg
ctcttgatgcttgctggcgctgccctgcgcggccacctgccggccgacgacggtgcaccg
ctcgcggcggccggcggcagccgggcggcgctgatgttcattgtcgccgcacttgccgcg
acgctcgcgctgatagcgctcgccatcatcacccggttgcgacatccgctcccggtggcg
cccagcgcgggggagctctcggcaatgcttggcggtgcagcagggcgtccgaactggcgt
gtgctgttgctcggactcgggacaatcctggcctggctgctgattgcgatactgctggca
cggttgttcgtgcccgatgatgtcggtcctgctgcgcccataccggattcaaccgctacg
ccggatgcttccagcaccacgccgtcgcgcccgcaaccgccgcaagacaacaatgacgac
gtgctcggcattctctttgccagcacaatcggcctgttcttgatggtcgtcgcggggtcg
ctgattacctcgcgacgacagcgcaagtcggcaccggctcgtatcagtggcgatcgcatc
gagtctccggcgccctcggcgcgttcggaatcactggcgcgtgccgccgagatcggactg
gccgagatggccgacctccgccgcgaaccacgggaggcgataattgcgtgttacgtggcg
atggagcgtgaactgtcgcatgttcccggtgttgcccctcaggacttcgacaccccgacc
gaggtgctggcccgagccgtcgaacaccgtgcgctccatggtgctagtgccgccgcgttg
gtgagcctgttcgccgaggcgcgttttagcccgcacgtgatgaacgaggagcaccgtgag
gtggcgatgcgtttgcttcgactggttcttgacgaactgagcactcggaccgctatatga

DBGET integrated database retrieval system