KEGG   Mycobacterium tuberculosis H37Rv: Rv3167cHelp
Entry
Rv3167c           CDS       T00015                                 

Definition
(RefSeq) TetR family transcriptional regulator
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_11 TetR_N HTH_Tnp_1_2
Motif
Other DBs
NCBI-GeneID: 888763
NCBI-ProteinID: NP_217683
TubercuList: Rv3167c
UniProt: A0A089QQL9 O53317
Position
complement(3535431..3536057)
Genome map
AA seq 208 aa AA seqDB search
MKADLPSLDKAPGAGRPRDPRIDSAILSATAELLVQIGYSNLSLAAVAERAGTTKSALYR
RWSSKAELVHEAAFPAAPTALQAAAGDIAADIRMMIAATRDVFTTPVVRAALPGLVADMT
ADAELNARVLARFADLFAAVRMRLREAVDRGEAHPDVDPDRLIELIGGATMLRMLLYPDD
MLDDAWVDQTTAIVVRGVHRAAPGGSVV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagacctgccctcccttgacaaggcccccggcgccgggcggccgcgtgatccg
cgcatcgactcggcgatcctgtcggcgacggcggaactgcttgtgcagatcgggtattcg
aacctcagcttggccgcggtcgccgaacgcgccggcaccaccaaatcggcgttgtaccgg
cggtggtcgagcaaggccgaactagtgcacgaggccgcgtttcccgccgcgcccaccgcg
ctgcaggctgcggccggtgatatcgccgccgacatccgaatgatgatcgcggccacccgc
gatgtgttcaccaccccggtggtgcgggccgcgttacccggtctggtagccgatatgacc
gcagacgctgaactcaacgcccgggtgctggcgcgttttgccgacttattcgccgcggtg
cgcatgcgcctgcgcgaggccgtcgaccgcggcgaggcgcatcccgacgtggacccggac
cggttgatcgagctgatcgggggcgccaccatgctgcggatgctgctgtacccggacgac
atgctggacgacgcgtgggtggaccaaaccaccgcgatcgtcgtgcgaggggtccaccgc
gccgctcctggcggcagtgtcgtctga

DBGET integrated database retrieval system