KEGG   Mycobacterium tuberculosis H37Rv: Rv3178Help
Entry
Rv3178            CDS       T00015                                 

Definition
(RefSeq) nitroreductase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420H2_quin_red
Motif
Other DBs
NCBI-GeneID: 888786
NCBI-ProteinID: NP_217694
TubercuList: Rv3178
UniProt: O53328 I6YFF9
Position
3546438..3546797
Genome map
AA seq 119 aa AA seqDB search
MRLGAGFRKPVPTLLLEHRSRKSGKNFVAPLLYITDRNNVIVVASALGQAENPQWYRNLP
PNPDTHIQIGSDRRPVRAVVASSDERARLWPRPVDAYADFDSCQSWTERGIPVIILRPR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
ttgcgactcggcgccggattccgcaaaccggtgccgacactgctactcgaacaccggagc
cgcaagtccggcaagaacttcgtcgcaccactgctttacatcaccgaccgtaacaatgtc
atcgtcgttgcctctgcccttgggcaggcagaaaacccgcagtggtatcgcaacctgccg
cccaatcccgacacccacattcagatcggatccgatcgccgcccggtgagagccgtcgtg
gccagctcggacgagcgggcgcgcctatggccgcgcccagtagacgcctacgccgacttc
gattcttgccaaagctggaccgagcgtgggattccggtgatcatcttgcggccacgctaa

DBGET integrated database retrieval system