KEGG   Mycobacterium tuberculosis H37Rv: Rv3191cHelp
Entry
Rv3191c           CDS       T00015                                 

Definition
(RefSeq) transposase
  KO
K07482  transposase, IS30 family
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Rv3191c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_38 HTH_23 rve HTH_32 Sigma70_r4_2 HTH_24 HTH_7 HTH_35 GerE HTH_IclR HTH_28 HTH_40
Motif
Other DBs
NCBI-GeneID: 887628
NCBI-ProteinID: NP_217707
TubercuList: Rv3191c
UniProt: L0TC33 O53337
Position
complement(3557311..3558345)
Genome map
AA seq 344 aa AA seqDB search
MRQISSRYLSEEERINIADLRRSGLSIRKIADQLGRAPSTVSRELRRNSRRDGQYRPFEA
HRWAVQRRVRRHRRRIDKNPDLCELIAELLAQRWSPQQIARHLRRKYPDDRSMWLCHESI
YQAVYQPQSRLIRPPQVKSPHRGPLRTGRTHRRAHLRPGRRRPRFAQPMLSIHQRPFDPA
DRSEPGHWEGDLIVGKNQGSAIGTLVERQTRLIRLLHLPTHDAYCLRIAITETMSDLPVT
LVRSITWDQGIEMARHIDITADLGAPVYFCDSRSPWQRASNENSNGLLRQYFPKGTSLST
YTPDHLRAVEYEINNRPRQVLGHRSPAELFTALLTSPDHQLLRR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccaaattagtagtcgctatctgtccgaggaggagcggatcaacatcgccgatctg
cgccgctcgggcctaagtatccgcaagatcgccgaccagctcggacgggcaccctcgacg
gtgtcgcgggagctacgccgcaacagtcgccgcgatggccagtaccggccgttcgaagcg
catcgctgggcggttcaacgccgagtccgccgtcaccggcgtcggatcgacaaaaacccc
gacctttgtgagctgatcgccgagctgctggcccagcggtggagcccgcaacagatcgcc
cggcatctgcgacggaaataccccgatgaccggtcgatgtggttgtgccacgaaagcatc
tatcaggccgtctatcagcctcaatcacgattgatccggccgccgcaggtcaagtcgcca
caccgtggccctctgcgcacgggacgaactcatcgccgcgcccatctgcgtcctggccgt
cgccgcccgcgcttcgcccagccgatgttgtcgattcaccagcggccgttcgatcccgcc
gaccgctccgagcctggccactgggaaggagatctcatcgttggtaagaaccagggctcg
gcgattggcaccctcgtcgagcgacagacacgtctgattcggctgctgcacctgccgacc
cacgacgcttactgcctgcgcatcgcgatcaccgagaccatgagcgacttgccggtgacg
ctggtccggtccatcacgtgggatcagggcatcgaaatggcccggcacatcgacatcacc
gccgacctgggcgcgccggtctacttttgcgactcccgctcaccgtggcagcgagccagc
aacgagaactccaacggtctgctacggcaatacttcccaaagggcaccagcctcagcacc
tacacgcccgaccatctgcgggctgtcgaatacgagatcaataaccgaccccgccaagtc
ctcgggcaccgcagtcccgctgaacttttcaccgcgctgctaacctcaccagaccatcaa
ttgttgcgacgttga

DBGET integrated database retrieval system