KEGG   Mycobacterium tuberculosis H37Rv: Rv3196AHelp
Entry
Rv3196A           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 3205082
NCBI-ProteinID: YP_177939
TubercuList: Rv3196A
UniProt: L7N668
Position
complement(3566696..3566896)
Genome map
AA seq 66 aa AA seqDB search
MQEGGPQETMSARSTQHDAADALFRAIIETLDKHRNERTLTEDVLDTLARAYASISTNVP
EQGRLG
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggagggtggaccgcaagaaaccatgtcagcaagatcaacgcagcacgacgctgcc
gacgccctgttcagagcgatcatcgaaacgctggacaagcaccgcaacgagcgcaccctg
acagaggacgtgctcgacaccttggccagagcctatgcgtcaatctcgaccaacgtgccg
gagcagggacgactgggttag

DBGET integrated database retrieval system