KEGG   Mycobacterium tuberculosis H37Rv: Rv3197AHelp
Entry
Rv3197A           CDS       T00015                                 

Gene name
whiB7
Definition
(RefSeq) transcriptional regulator WhiB7
  KO
K18958  WhiB family transcriptional regulator, redox-sensing transcriptional regulator
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mtu03000]
    Rv3197A (whiB7)
Transcription factors [BR:mtu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Rv3197A (whiB7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Whib AT_hook
Motif
Other DBs
NCBI-GeneID: 3205083
NCBI-ProteinID: YP_177940
TubercuList: Rv3197A
UniProt: Q6MX01 I6YFH5
Position
complement(3568401..3568679)
Genome map
AA seq 92 aa AA seqDB search
MSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRA
EPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtactgacagtccccagacagacccccagacaaagattgccggttttgccgtgc
cacgtcggtgatcccgatctgtggttcgccgataccccggccggtctcgaggtagccaag
acactgtgtgtgagctgcccgatcaggcggcagtgcttggccgcggcgcttcagcgggct
gaaccctggggcgtttggggtggtgagatattcgaccaaggctcgatcgtgagtcacaag
cgtccgcgcggacgtccgcgcaaggatgctgttgcatag

DBGET integrated database retrieval system