KEGG   Mycobacterium tuberculosis H37Rv: Rv3223cHelp
Entry
Rv3223c           CDS       T00015                                 

Gene name
sigH
Definition
(RefSeq) ECF RNA polymerase sigma factor SigH
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mtu03021]
    Rv3223c (sigH)
Transcription machinery [BR:mtu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Rv3223c (sigH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4
Motif
Other DBs
NCBI-GeneID: 888094
NCBI-ProteinID: NP_217739
TubercuList: Rv3223c
UniProt: P9WGH9
Position
complement(3598901..3599551)
Genome map
AA seq 216 aa AA seqDB search
MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQE
TMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEH
SSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTV
MSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcgatggtgtaaccggttcggcgggtctgcagcctgggccgtctgaggag
acagacgaggagttgaccgcgcgtttcgagcgcgacgcgattcccctgttggaccagctg
tacggcggtgcgctgcggatgacgcgcaatccggccgacgccgaggacttgctccaggag
acgatggtgaaggcctatgcgggatttcgttcgttccggcacggtaccaatctcaaggcc
tggctctaccggatactgaccaacacctacatcaacagctatcgcaagaaacagcggcaa
ccggcggagtatccgaccgagcagatcaccgattggcaactggcgtccaacgccgagcat
tcctcgaccgggctgcgctcggctgaagtcgaagcgttagaagcgttgccggacaccgag
atcaaagaggcgctgcaggcattgccggaagagttccggatggcggtctactacgccgat
gtcgaaggtttcccctacaaggagatcgccgagatcatggatactccgatcggcaccgtg
atgtcgaggcttcatcgcggccgacgtcagttgcgcggtcttttagccgatgtggccagg
gatcgggggtttgccaggggcgagcaggcgcacgagggggtgtcgtcatga

DBGET integrated database retrieval system