KEGG   Mycobacterium tuberculosis H37Rv: Rv3229cHelp
Entry
Rv3229c           CDS       T00015                                 

Gene name
desA3
Definition
(RefSeq) stearoyl-CoA 9-desaturase
  KO
K22769  NADPH-dependent stearoyl-CoA 9-desaturase [EC:1.14.19.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rv3229c (desA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv3229c (desA3)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.-  
     Rv3229c (desA3)
Lipid biosynthesis proteins [BR:mtu01004]
 Desaturase
  First
   Rv3229c (desA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Chlorovi_GP_rpt
Motif
Other DBs
NCBI-GeneID: 888821
NCBI-ProteinID: YP_177948
TubercuList: Rv3229c
UniProt: P9WNZ3 I6XGN6
Position
complement(3605751..3607034)
Genome map
AA seq 427 aa AA seqDB search
MAITDVDVFAHLTDADIENLAAELDAIRRDVEESRGERDARYIRRTIAAQRALEVSGRLL
LAGSSRRLAWWTGALTLGVAKIIENMEIGHNVMHGQWDWMNDPEIHSSTWEWDMSGSSKH
WRYTHNFVHHKYTNILGMDDDVGYGMLRVTRDQRWKRYNIFNVVWNTILAIGFEWGVALQ
HLEIGKIFKGRADREAAKTRLREFSAKAGRQVFKDYVAFPALTSLSPGATYRSTLTANVV
ANVIRNVWSNAVIFCGHFPDGAEKFTKTDMIGEPKGQWYLRQMLGSANFNAGPALRFMSG
NLCHQIEHHLYPDLPSNRLHEISVRVREVCDRYDLPYTTGSFLVQYGKTWRTLAKLSLPD
KYLRDNADDAPETRSERMFAGLGPGFAGADPVTGRRRGLKTAIAAVRGRRRSKRMAKSVT
EPDDLAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcactgacgtcgacgtattcgcgcatctgacggacgccgacattgaaaacctg
gccgccgagctagatgccatccgccgagacgttgaagaatcgcgcggcgaacgcgatgcc
cgctacatccgccgcaccatcgccgcacagcgggcgctcgaggtgtccggtcggctactg
ctggctggcagctcacgacgcctcgcctggtggacaggtgccctgacccttggcgtggcc
aagatcatcgaaaacatggagatcggccacaacgtcatgcacggccagtgggactggatg
aacgacccggagattcactcctcgacgtgggagtgggacatgagcggatcgtccaagcac
tggcgctacacccacaacttcgtgcaccacaaatacaccaacatcctcggtatggatgac
gacgtcggatacggcatgctgcgcgtcacccgtgaccagcgctggaagcgctacaacatc
ttcaacgtggtgtggaacaccatccttgcgatcggcttcgagtggggagttgcgctgcag
cacttggagatcggcaagatcttcaagggtcgggccgaccgcgaggccgctaaaacccgg
ttgcgtgaattctcagccaaagcgggccgccaggtgttcaaggactatgtcgcgttcccg
gcgctgacctcgttgtccccgggggcgacgtatcggtccactttgaccgccaacgtggtg
gccaacgtgatccgcaacgtgtggtccaacgcggtgatcttctgcggccatttcccggat
ggcgcagagaaattcaccaagacggacatgatcggtgagccgaagggccagtggtaccta
cggcagatgctgggcagcgcaaacttcaacgctgggccggcgctgcggttcatgagcggc
aatctgtgccaccaaatcgagcatcacctctatccggacctgccgagcaaccggcttcac
gagatttcggtgcgggtgcgtgaggtctgcgacagatacgacttgccatacaccacgggc
tcgttcttggtgcagtacggcaagacctggcgcacccttgccaagctgtcgttgccggat
aagtacttacgtgacaacgctgacgatgcacccgagacccgcagtgagcggatgttcgct
ggtctggggccgggtttcgcgggcgccgatccggtgaccggacgtcgtcgggggttaaag
accgcgattgccgccgtgcggggtcggcggcgcagcaagcgtatggctaagtcggtcacc
gaacccgacgatctggcagcctaa

DBGET integrated database retrieval system