KEGG   Mycobacterium tuberculosis H37Rv: Rv3237cHelp
Entry
Rv3237c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
  KO
K07228  TrkA domain protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Rv3237c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C
Motif
Other DBs
NCBI-GeneID: 888803
NCBI-ProteinID: NP_217754
TubercuList: Rv3237c
UniProt: L0TDK1 O05882
Position
complement(3613121..3613603)
Genome map
AA seq 160 aa AA seqDB search
MDVKEVLLPGVGLRYEFTSYRGDRIGIVARRSGGFDVVLYGRDDPDEARPVLRLTDEEAE
AVAQILGAPRIAERFTELTREVPGLKAGQIHIRAGSLFVDRPLGDTRARTRTGASIVAIV
RDEDVLASPGPTDVLRAGDVLIVIGTEDGIAGVEQIVEKG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaggaggtgctgctgccgggggtgggcctgcgatacgagttcaccagctat
cgcggtgaccggatcggcatcgttgccaggcgcagtggcggtttcgacgtcgtcctgtat
ggccgcgatgatccggacgaagcccgaccggttttgcggctcaccgatgaagaggccgag
gcggtggctcagattctgggtgcgccgaggatcgccgagcgatttaccgagctgacgcgt
gaggtgcccgggcttaaggccggtcagattcacatccgggcgggtagcttgtttgtggac
cggccgctgggtgatacccgtgcgcgcacccgtaccggcgcgtcgattgtggcgatcgtg
cgtgacgaggatgtgttggcctcgccgggcccgactgatgtgctgcgagccggagatgtc
ctcatcgtgatcggcaccgaggacgggatcgccggggtcgaacagatcgtcgaaaagggc
tga

DBGET integrated database retrieval system