KEGG   Mycobacterium tuberculosis H37Rv: Rv3253cHelp
Entry
Rv3253c           CDS       T00015                                 

Definition
(RefSeq) cationic amino acid transport integral membrane protein
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Rv3253c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C PrgI
Motif
Other DBs
NCBI-GeneID: 888739
NCBI-ProteinID: NP_217770
TubercuList: Rv3253c
UniProt: O05896 L0TBZ9
Position
complement(3632097..3633584)
Genome map
AA seq 495 aa AA seqDB search
MAGRRRMKSVEQSIADTDEPTTRLRKDLTWWDLVVFGVSVVIGAGIFTVTASTAGDITGP
AIWISFLIAAATCALAALCYAEFASTLPVAGSAYTFSYATFGEFLAWVIGWNLVLELAMG
AAVVAKGWSSYLGTVFGFGNGTGHLGSLQLDWGALVIVTLVATLIALGTKLSSRFSAVVT
AIKVSVVVLVVVVGAFYIRAANYSPFIPEPEVQHHGGGLDQSVFSLLTGAQGSHYGWYGV
LAGASIVFFAFIGFDIVATMAEETKRPQRDVPRGILASLGVVTLLYVAVSVVLSGMVPYT
QLRTVPGRGPANLATAFQANGVYWASGIISVGALAGLTTVVMVLMLGQCRVLFAMARDGL
VPRQLAKTGSRGTPVRVTVLVAVLVATTASVFPITKLEEMVNVGTLFAFILVSAGVVVLR
RTRPDLQRGFTAPWVPLLPIAAVCACLWLMLNLTALTWIRFGIWLVAGTAIYVGYGRRHS
AQGLRQARESATRRC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccggtcgacggcgcatgaagtcggtagaacagtcaatcgccgacaccgacgagccc
accactcggctgcgcaaggacctcacctggtgggacctggttgttttcggcgtctcggtg
gtgattggcgccggaatattcacggttaccgcgtcgaccgctggcgatatcaccggcccg
gccatctggatatcgtttctgatcgcggcggcgacctgtgcgctggccgcgctgtgctac
gccgagttcgcctcgacgctgccggtggccggcagcgcctataccttctcttatgccacc
ttcggggagttcttggcctgggtgatcggctggaatctggtgctggaactggcgatgggt
gcggccgtggtcgccaaaggctggtccagctacttgggcaccgtgttcggattcggtaat
ggcacaggccatctcggatcgctgcagctcgactggggtgcgctcgtgatcgtcacgttg
gtggcgaccctgatcgcgttgggcaccaaattgtcgtcgagattttccgcggtggtcacc
gcaatcaaggtgtcggtggtcgtcttggtggtggtcgtcggtgccttctacatcagggcc
gccaactactcgccgttcattcccgagcccgaagtccagcaccacggcggcgggctcgat
caatccgtcttctcgttgctgaccggagcccaaggcagccactacggatggtacggcgtg
ctggccggggcatcgatcgtgttcttcgcgtttatcgggtttgacatcgtggccaccatg
gccgaggagaccaagcgtcctcaacgagacgtccctcgagggattctcgcgtcgctgggg
gtcgtgacccttctctacgtcgcggtatcggtggtgctgtcgggcatggttccatacacc
caactgcggaccgtaccgggccgcgggccggcaaatctggccaccgcgttccaggccaac
ggggtgtactgggccagcggcatcatctccgtcggcgcgctggccgggcttaccacggtg
gtgatggtgttgatgctcgggcaatgccgcgtgctgttcgccatggcgcgcgacggcttg
gtgccgcggcaattggccaagaccggttcgcgcggcaccccggtccgggtcacggtgctg
gtcgcggtgttggtggccacgacggcgtcggtgtttccgatcaccaagcttgaggagatg
gtcaacgtcgggacactgttcgcgttcatcctcgtctcggccggagtggtcgtgctgcgc
cggacccgacccgaccttcagcgggggttcacagctccgtgggtgccgttacttccgatc
gccgcagtgtgcgcgtgcctgtggctgatgctgaacctcaccgcgttgacttggatccgg
ttcgggatctggctggtggccggaaccgcgatttatgtcggctacgggcgccggcactcg
gcgcagggccttcggcaagctcgagagagcgcgacccggaggtgttga

DBGET integrated database retrieval system