KEGG   Mycobacterium tuberculosis H37Rv: Rv3256cHelp
Entry
Rv3256c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 888696
NCBI-ProteinID: NP_217773
TubercuList: Rv3256c
UniProt: O05899 L0TET0
Position
complement(3636275..3637315)
Genome map
AA seq 346 aa AA seqDB search
MNVARAIDLEDTEGLIAADRGALLRAASMAGAQVRAIAAAADEGELDLLRGSDRPRSVIW
VTGRGTAETAGTILASTLGAGAAEPIVLASAAPPWVGPLDVLIVAGDDPGDPALVGAAAI
GVRRGARVVVVAPYEGPLRDSTAGRVAVLEPRLRVPDEFGLSRYLAAGLAALQTVDPKLR
IDLASLADELDAEALRNSAGREVFTNPAKALAARVSGCQLALAGDNAATLALARHGSSVM
LRIANQVVAATRLSDAVVALRAGTPPDALFHDEEIDGPAPQRLRVLALALAGERTVVAAR
VAGLDDAYLVAAEDVPELLDAPVGSGGAVLAVRLEMAAVYLRLVRG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtcgcccgggcgatcgatctcgaggacaccgaaggcctgatcgctgccgaccgg
ggtgccctgctgcgggccgcatcgatggccggcgcacaggtgcgtgccatcgctgccgcg
gccgacgagggcgaactggacttgctgcgcggtagtgaccgtccccgctcggtgatctgg
gtgaccggccgggggaccgctgagaccgccgggaccatcctggcctcgacgctaggtgcc
ggggccgccgagccgatcgtgctcgccagtgcggcgccgccctgggtcgggccgcttgac
gtgctgatcgttgccggcgacgaccccggcgacccggcgctggtcggggccgccgcgatc
ggggtgcgcaggggcgcgcgggttgtcgtggtggcaccgtatgagggtccgctgcgggac
agcacggccggtcgcgtcgcggtgctggaaccgcggctgcgggttcctgacgagttcggg
ttgtcccggtacctggccgcgggtctggcggccttgcaaaccgtggatcccaagctgcgc
atcgatctggcgtcgctggcagacgagctggatgctgaggcgctccgcaacagcgccggc
cgagaggtgttcaccaacccggccaaggcacttgccgctcgcgtttccggttgccagctg
gccctggctggagacaatgccgcgacgctggcgctggcccggcatgggagttcggtcatg
ctgcggatcgcaaaccaggttgtggccgctaccaggctttcggatgcggttgtggcgcta
cgtgccgggacgccgccggatgcgctgttccatgacgaggaaatcgatgggccggcaccg
cagcggctgcgggtgttggcgctggcgctggccggcgagcggacggtggtggccgctcgg
gttgccgggctcgatgacgcctatctggtcgcggctgaggatgtgccggagctgctcgac
gcccccgtgggatccgggggggcggtattggccgttcggctggagatggccgccgtgtat
ctgcgactggtgcgaggatag

DBGET integrated database retrieval system