KEGG   Mycobacterium tuberculosis H37Rv: Rv3268Help
Entry
Rv3268            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 888703
NCBI-ProteinID: NP_217785
TubercuList: Rv3268
UniProt: A0A089QQV2 P96873
Position
3649420..3650109
Genome map
AA seq 229 aa AA seqDB search
MLRADPVGPRITYYDDATGERIELSAVTLANWAAKTGNLLRDELAAGPASRVAILLPAHW
QTAAVLFGVWWIGAQAILDDSPADVALCTADRLAEADAVVNSAAVAGEVAVLSLDPFGRP
ATGLPVGVTDYATAVRVHGDQIVPEHNPGPVLAGRSVEQILRDCAASAAARGLTAADRVL
STASWAGPDELVDGLLAILAAGASLVQVANPDPAMLQRRIATEKVTRVL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgccgacccggtcggcccgcgcatcacctactatgacgatgccaccggtgag
cgcatcgagctatccgcggtgacactggctaactgggccgccaagaccggcaacctgttg
cgcgacgagctggcggccggacccgccagccgagtcgcgatcctattaccggcccattgg
cagaccgcggcggtgttgttcggcgtgtggtggatcggtgcgcaagcgatactcgacgat
tctcccgccgatgtggcactgtgcaccgccgaccgtctggccgaagccgacgccgtcgtc
aacagcgcggcggtagccggcgaggtagccgtgctgtcgctggatccattcggtcgaccg
gcaaccggcctgccggtcggcgtcaccgactatgcgaccgcggtgcgggtacacggcgac
cagatagttcccgaacacaaccccggtccggtgcttgccggtagatccgtcgagcagatc
ctgcgcgactgcgcggcgtccgcggccgccaggggtttgacggcggcggatcgggtgctg
tccaccgcttcctgggccggacccgatgagttggtggacggcctgctggcgatcctggcc
gccggtgcgtcgttggtgcaggtggccaatcccgatccggcgatgctgcagcgcaggatt
gcgaccgaaaaggtcacccgcgtcctgtga

DBGET integrated database retrieval system