KEGG   Mycobacterium tuberculosis H37Rv: Rv3275cHelp
Entry
Rv3275c           CDS       T00015                                 

Gene name
purE
Definition
(RefSeq) 5-(carboxyamino)imidazole ribonucleotide mutase
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv3275c (purE)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     Rv3275c (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC Thi4
Motif
Other DBs
NCBI-GeneID: 888721
NCBI-ProteinID: NP_217792
TubercuList: Rv3275c
UniProt: P9WHM1 I6X6V6
Structure
PDB: 

Position
complement(3658114..3658638)
Genome map
AA seq 174 aa AA seqDB search
MTPAGERPRVGVIMGSDSDWPVMADAAAALAEFDIPAEVRVVSAHRTPEAMFSYARGAAE
RGLEVIIAGAGGAAHLPGMVAAATPLPVIGVPVPLGRLDGLDSLLSIVQMPAGVPVATVS
IGGAGNAGLLAVRMLGAANPQLRARIVAFQDRLADVVAAKDAELQRLAGKLTRD
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgccggcgagcggccccgggtcggggtgatcatgggcagcgacagcgactgg
ccggtgatggccgacgctgcggcggcgctggccgagttcgacattccggccgaggttcgg
gttgtttcggcccatcgcacccctgaggcgatgttcagttatgcgcgcggcgcggccgag
cgcggtctcgaggtgatcatcgccggagcgggcggggccgcgcacttgcccggtatggtc
gccgccgcgacgccgctgccggtgatcggggtgccggtaccgctgggcaggctggacggc
cttgactccctgctgtcgatcgtgcaaatgccggccggggttccggtggccacggtgtcc
atcgggggcgccggtaatgccggactgctggcggtgcggatgctgggagccgccaacccc
cagctgagggcccggatcgtcgcattccaggaccggctggccgacgtcgtggcggccaag
gatgcggaactgcagcggcttgcgggtaagttaacccgcgactag

DBGET integrated database retrieval system