KEGG   Micromonospora tulbaghiae: CSH63_02125Help
Entry
CSH63_02125       CDS       T05651                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mtua  Micromonospora tulbaghiae
Pathway
mtua00260  Glycine, serine and threonine metabolism
mtua01100  Metabolic pathways
mtua01110  Biosynthesis of secondary metabolites
mtua01120  Microbial metabolism in diverse environments
mtua01130  Biosynthesis of antibiotics
mtua01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CSH63_02125
Enzymes [BR:mtua01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CSH63_02125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AYF26280
UniProt: A0A386WFQ3
Position
431292..432320
Genome map
AA seq 342 aa AA seqDB search
MGEVIDLRTDTVTRPTPGMREAMAAAEVGDDVYGEDPTVTALEAEVAALFGHEAALFAPS
GSMANQIALQLHVPPGDELLCDADAHVVTYEVGAAAAYGGISSRTWPAVGAELDPDVVAG
MIRPDGYFAVPTRAIAVEQTHNRGGGGVIPLPTLRRMRAVADEHGVALHCDGARIWHAHV
ADGVPLAGYGVLFDTLSVCLSKGLGAPVGSLIVGSAEKIARARFLRKRMGGGMRQVGILA
AAGRYALAHHVERLADDHVKAARLAEAVAPHGVLASVVRTNIVPLDLTKHPLDAHALAAA
ARAEGLLISVLGPRTARLVTHLDVTDAQIDRAATILNTALRA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgaggtcatcgatctgcggacggacaccgtgacccggccgacgccggggatgcgg
gaggcgatggccgccgccgaggtgggcgacgacgtctacggcgaggatccgacggtcacc
gcgctggaggccgaggtggccgcgctgttcggccacgaggcggcgctgttcgccccgagc
ggctcgatggccaaccagatcgcgctccagttgcacgtaccgcccggcgacgagttgctc
tgcgacgccgacgcgcacgtggtcacgtacgaggtcggcgccgccgccgcgtacggcggg
atctcctcgcggacctggcccgcggtgggcgcggagctggaccccgacgtggtcgccggg
atgatccggccggacggctacttcgcggtgcccacacgggcgatcgccgtggagcagacc
cacaaccggggcggcggtggggtgatcccgctgccgacgctgcgccggatgcgtgcggtc
gccgacgagcacggggtggccctgcactgcgacggcgcgcgcatctggcacgcgcacgtg
gccgacggggtgccgctggccgggtacggcgtgctgttcgacacgctctcggtctgcctc
tccaagggcctcggcgcgccggtcggctcgctgatcgtgggcagcgcggagaagatcgcc
cgggcgcggttcctgcgcaagcggatgggcggcggcatgcggcaggtgggcattctcgcc
gccgcgggccggtacgcgctggcgcaccacgtcgagcggctggccgacgaccacgtcaag
gcggcccggctggccgaggcggtcgccccgcacggggtgctcgcgtcggtggtgcggacc
aacatcgtgccgctggacctgaccaagcacccgctggacgcgcacgcgctggcggcggcc
gcgcgggcggaggggctgctgatctcggtgctcggcccgcgtaccgcccggctggtcacc
cacctggacgtcaccgacgcgcagatcgaccgcgccgccaccatcctgaacaccgccctg
cgcgcctga

DBGET integrated database retrieval system