KEGG   Micromonospora tulbaghiae: CSH63_03680Help
Entry
CSH63_03680       CDS       T05651                                 

Definition
(GenBank) glycosyl transferase family 1
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
mtua  Micromonospora tulbaghiae
Pathway
mtua00500  Starch and sucrose metabolism
mtua01100  Metabolic pathways
Module
mtua_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CSH63_03680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtua01003]
    CSH63_03680
Enzymes [BR:mtua01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CSH63_03680
Glycosyltransferases [BR:mtua01003]
 Polysaccharide
  Storage polysaccharide
   CSH63_03680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: AYF26586
UniProt: A0A386WDX8
Position
complement(780626..782023)
Genome map
AA seq 465 aa AA seqDB search
MGGDPTGHRGDAAGVGTPQLKGGRVSADAEVIDILPARRLRVLLLSWEYPPVLVGGLGRH
VHALSVALAAAGHEVTVVTRHAEGAPLEEYADGVRVVRAAEDPVRFPLATGSLLAWTMAF
NHTLTRAALRAASTGSYDVIHAHDWLVAHTAVTLAEHLDVPLVTTIHATEAGRHQGWLPE
EMNRTIHGVEHWLSNASGRVIACSGYMRDQVARLFGVPAGRIDVVANGVDDRAWRARPHA
VASARARFAAGGPLVGYAGRLVYEKGVQHLVHAVPHLAKRHPRLRVVIAGDGPYKDELVD
QARRLHLGDTVRFAGFMDATQLPAVLAATDATVIPSLYEPFGMIALEAAAAGAPLAVART
GGLAEIVEPGVTGVTFPHGDPDALAGAVDRLLGDEVFARRVARKARTMVSRRYTWSAIAA
RTAGSYAAARRDHDAFQARRATAMLAGDRSPIAVPEGNLLAGAAG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgaccccaccggacaccgcggcgacgccgccggggtggggacgccacaactc
aaagggggccgcgtgtcagctgacgccgaagtgatcgacatcctgcccgcccggcgcctg
cgggtgctgctgctctcctgggagtacccgccggtgctcgtcggtggcctcggccgccac
gtccacgcgctgtccgtggcgctggccgccgccgggcacgaggtcacagtcgtcacccgc
cacgccgagggcgctcccctggaggagtacgccgacggcgtgcgcgtcgtccgcgccgcc
gaggacccggttcggttcccgctggccaccggatcgctgctggcctggaccatggcgttc
aaccacaccctgacccgggccgcgctgcgcgccgcctccaccggctcgtacgacgtcatc
cacgcccacgactggctcgtcgcgcacaccgccgtcacgctggccgagcatctcgacgtg
ccgctggtgaccaccatccacgccaccgaggcgggccggcaccagggctggctgccggag
gagatgaaccgcaccatccacggcgtcgaacactggctgagcaacgcctccggccgggtg
atcgcctgctccgggtacatgcgcgaccaggtggcccggctgttcggcgtgccggccggg
cgcatcgacgtggtcgccaacggcgtcgacgaccgggcctggcgggcgcggccgcacgcg
gtcgcctccgcccgggcgcgcttcgccgcgggcgggccgctcgtcgggtacgccggccgg
ctggtctacgagaagggcgtgcagcacctggtgcacgccgtgccgcacctggcgaagcgg
cacccccgcctgcgggtggtgatcgccggggacgggccgtacaaggacgagctggtcgac
caggcgcgacggctgcacctgggggacacggtccggttcgccggtttcatggacgccacc
caactgcccgcggtgctcgccgccaccgacgccactgtgatccccagcctctacgagccg
ttcggcatgatcgcgctggaggcggcggccgccggagcaccgctcgcggtggcgcgcacc
ggcgggctggccgagatcgtcgagcccggcgtgaccggcgtgacgttcccgcacggcgac
ccggacgcgctggccggcgccgtcgaccggctgctcggcgacgaggtcttcgcccggcgg
gtggcgcgcaaggcccggaccatggtcagccggcggtacacctggtccgcgatcgccgcc
cggaccgccggaagctacgccgccgcccgccgcgaccacgacgcgttccaggcccgccgg
gccaccgccatgctggccggcgaccggtccccgatcgccgtcccggagggcaacctgctc
gccggcgcggcaggttag

DBGET integrated database retrieval system