KEGG   Micromonospora tulbaghiae: CSH63_16535Help
Entry
CSH63_16535       CDS       T05651                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
mtua  Micromonospora tulbaghiae
Pathway
mtua00450  Selenocompound metabolism
mtua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CSH63_16535 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mtua03016]
    CSH63_16535 (selD)
Enzymes [BR:mtua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CSH63_16535 (selD)
Transfer RNA biogenesis [BR:mtua03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    CSH63_16535 (selD)
 Prokaryotic type
    CSH63_16535 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS AIRS_C
Motif
Other DBs
NCBI-ProteinID: AYF29037
UniProt: A0A386WL36
Position
complement(3673377..3674366)
Genome map
AA seq 329 aa AA seqDB search
MTDAIRLTDYARGGGCACKIPPGELEAMVAGLGATGGSADLLVGLENGDDAAVVRLDERT
GLVSTADFFTPVVDDAYDWGRIAAANALSDVYAMGGTPLVALNLLCWPRGVLPPEMAREV
LRGGLDVAREADCHLAGGHSVDDDGPKYGLAVTGVVRPEELITLDAGRAGLPLSLTKPLG
VGVLNTRHKQTGQRFPEAVESMARLNRDAARAAVAAGIRCGTDVTGFGLLGHASKLARAS
RLTVAIDAAAVPYLPGAREALRDGYVSGGTRRNLEWVMPWTDFGGADEGERLLLADAQTS
GGLLVAGEVPGGTVIGELLPASEHLIRVR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgatccggctgaccgactacgcccgcggtggcggttgcgcctgcaagatc
ccacccggcgagctggaggcgatggtcgccggtctcggcgccaccggcggctcggccgac
ctgctggtcggcctggagaacggcgacgacgccgcggtggtccggctggacgagcgtacg
ggcctggtgagcaccgccgacttcttcaccccggtggtcgacgacgcctacgactggggg
cgcatcgccgccgccaacgcgctctccgacgtgtacgcgatgggcggcaccccgctcgtc
gcgctgaacctgctctgctggccgcgcggggtgctgccgccggagatggcccgcgaggtg
ctgcgcggcggtctggacgtggcccgggaggcggactgccacctggccggcgggcacagc
gtggacgacgacggcccgaagtacggcctggcggtcaccggcgtggtccggccggaggag
ctgatcacgctcgacgccgggcgggcggggctgccgctgtcgctgaccaagccgctcggg
gtgggcgtgctcaacacccggcacaagcagaccgggcagcgcttccccgaggcggtcgag
tcgatggcccggctcaaccgggacgcggcccgcgcggcggtggccgcgggcatccgctgc
ggcaccgacgtgaccggcttcggcctgctcgggcacgcctcgaagctggcccgcgcgagc
cgcctgacggtggcgatcgacgcggcggcggtgccgtacctgccgggtgcgcgggaggcg
ttgcgcgacgggtacgtcagcggtggcacccggcgcaacctggagtgggtcatgccgtgg
accgacttcggcggtgcggacgagggggagcggctgctcctcgccgacgcgcagacctcc
ggtggcctgctggtcgccggtgaggtgccgggcggcacggtgatcggtgagctgctgcct
gcttcggagcatctgatccgggtgcgctga

DBGET integrated database retrieval system