KEGG   Micromonospora tulbaghiae: CSH63_28685Help
Entry
CSH63_28685       CDS       T05651                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mtua  Micromonospora tulbaghiae
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CSH63_28685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1 DUF2613
Motif
Other DBs
NCBI-ProteinID: AYF31352
UniProt: A0A386WTM7
Position
6153537..6154541
Genome map
AA seq 334 aa AA seqDB search
MSPELIAVLAVIAVAMAFDYTNGFHDAANAIATSISTRALTPRIALALAAVGNFVGAHFG
AGVAKTVGDGLVTLPTGVESLGVVFAGVLGAIIWNLITWYFGLPSSSSHALFGGLVGATL
FAADGIVQWGTIIEKVLVPMVLSPVVGLILGFLVMLAIMWLFRKGQPGKLSRGFRWAQTA
SAAAMSVGHGMQDAAKTMGIIVLALYTGGFQESKTHIPGWVFWTSAAMLAAGTYAGGWRI
IRTLGRKIIDLGPAEGFAAETVASAVLYFNALVLKAPISTTHTITSAIMGVGATKRLSAV
RWNVAGNIVIAWIITFPAAAAIACLAYLLVRPLF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcccgaactcatcgccgtgctggcggtgatcgcggtcgccatggcgttcgactac
acgaacggcttccatgacgcggcaaacgcgatcgccaccagcatctcgacccgggcgctg
accccccggatcgccctggcgctggcggcagtcggcaacttcgtcggcgcgcacttcggc
gccggcgtcgccaagacggtcggcgacgggctggtgacgttgccgaccggggtggagagc
ctcggcgtggtcttcgccggcgtgctcggcgcgatcatctggaacctgatcacctggtac
ttcggcctgccgtcctcgtcctcgcacgccctcttcggcggcctggtcggcgcgaccctg
ttcgccgccgacggcatcgtccagtggggcaccatcatcgagaaggtcctcgtcccgatg
gtgctctcgccggtggtcggcctgatcctgggcttcctggtgatgctggcgatcatgtgg
ctgttccggaagggccagcccggcaagctcagccgcggcttccggtgggcgcagaccgcg
tccgccgccgccatgtcggtcggccacggcatgcaggacgccgccaagaccatgggcatc
atcgtgctcgcgctctacaccggcggcttccaggagagcaagacgcacatcccgggctgg
gtcttctggacctccgccgcgatgctggcggccggcacgtacgcgggcggctggcggatc
atccggacgctcggccggaagatcatcgacctcggcccggcggagggcttcgcggccgag
accgtggccagcgcggtgctctacttcaacgcgctggtgctgaaggcaccgatctccacc
acgcacacgatcacctcggcgatcatgggtgtgggcgcgacgaaacggctctccgcggtg
cgctggaacgtggcaggcaacatcgtgatcgcctggatcatcacgttcccggccgccgcc
gcgatcgcctgcctcgcgtacctgctggtccggcccctgttctga

DBGET integrated database retrieval system