KEGG   Micromonospora tulbaghiae: CSH63_32475Help
Entry
CSH63_32475       CDS       T05651                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mtua  Micromonospora tulbaghiae
Pathway
mtua00220  Arginine biosynthesis
mtua00330  Arginine and proline metabolism
mtua01100  Metabolic pathways
mtua01110  Biosynthesis of secondary metabolites
mtua01130  Biosynthesis of antibiotics
mtua01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CSH63_32475
   00330 Arginine and proline metabolism
    CSH63_32475
Enzymes [BR:mtua01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CSH63_32475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AYF32072
UniProt: A0A386WVH1
Position
6997161..6998330
Genome map
AA seq 389 aa AA seqDB search
MMRRIAVLDAPTNLGLRPPTASSVPGCAKAPGALRDHGLLARLRARDAGCLTPPRYDPGD
WRPGDGVCHAPEISAYSAALADRIGAIIDRGEFPLVLGGDCSVLLGSALAMHRLGEAVGG
RIGLVFVDGHSDFRHPGNASYVGAAAGEDLALVTGRGQPDLAAIEGRRPYFRDIDVVVLG
IRAQDEYRLDLQAAGITTRPVPALRAEGAARTAQWAHEQLVDCAGYWVHIDVDVLDPAVM
PAVDAPDPGGIAFAELEILLAGLVDTPHCLGVELTVFDPDYDPDGAYAAEIVNTVVAGLA
PVVAPGAVPPRLLPAGPVAPAPRAADSRPEPEPLPAPAAVPAPAVAVEPIGPDPTAADDL
GEDPLGPGLLRRAPAGDEPDPARSGIDIA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccggatcgccgtcctcgacgcgccgacgaacctcggactgcgcccgcccacc
gcgagctccgtccccggctgcgccaaggcgccgggtgcgctgcgcgaccacggcctgctc
gcccggctgcgggcccgcgacgccggctgcctcaccccgccccggtacgacccgggggac
tggcgccccggcgacggcgtctgccacgcgccggagatctccgcgtactcggcggcgctc
gccgaccggatcggcgcgatcatcgaccggggcgagttcccgctggtgctcggcggcgac
tgctcggtgctgctcggctcggcgctggccatgcaccgcctcggtgaggcggtcggcggg
cggatcgggctggtcttcgtcgacggccactccgacttccggcaccccggcaacgcctcc
tacgtcggcgcggcagccggggaggacctggccctggtcaccggccggggacagcccgac
ctggccgcgatcgagggccggcggccctacttccgggacatcgacgtggtggtgctcggc
atccgcgcgcaggacgagtaccggctcgacctccaggccgccggcatcaccacccggccg
gtgccggcgctgcgcgccgagggtgccgcccggaccgcgcagtgggcgcacgagcagctc
gtcgactgcgccgggtactgggtgcacatcgacgtggacgtgctcgacccggcggtgatg
cccgccgtggacgcgcccgacccgggcggcatcgccttcgccgagctggagatcctgctc
gccgggctggtcgacaccccgcactgcctcggcgtcgagctgaccgtcttcgaccccgac
tacgacccggacggggcgtacgcggccgagatcgtgaacacggtggtggccgggctcgcc
ccggtggtcgcgccgggcgccgtgccgccccggctgctgccggccgggccggtcgcgccg
gcgccccgcgccgccgacagccggcccgagcccgagccgctgcccgccccggctgccgta
ccggcgccggcggtcgcggtggagccgatcggccccgacccgaccgccgccgacgacctc
ggcgaggacccgctggggcccggcctgctgcgtcgcgcgcccgccggggacgagccggac
ccggcccgctccggcatcgacatcgcctga

DBGET integrated database retrieval system