KEGG   Mycobacterium tuberculosis 7199-99: MT7199_0471Help
Entry
MT7199_0471       CDS       T02617                                 

Gene name
lpdC
Definition
(GenBank) DIHYDROLIPOAMIDE DEHYDROGENASE LPD (LIPOAMIDE REDUCTASE (NADH)) (LIPOYL DEHYDROGENASE) (DIHYDROLIPOYL DEHYDROGENASE) (DIAPHORASE)
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00010  Glycolysis / Gluconeogenesis
mtub00020  Citrate cycle (TCA cycle)
mtub00260  Glycine, serine and threonine metabolism
mtub00280  Valine, leucine and isoleucine degradation
mtub00310  Lysine degradation
mtub00380  Tryptophan metabolism
mtub00620  Pyruvate metabolism
mtub00630  Glyoxylate and dicarboxylate metabolism
mtub00640  Propanoate metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01130  Biosynthesis of antibiotics
mtub01200  Carbon metabolism
Module
mtub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtub_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtub_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT7199_0471 (lpdC)
   00020 Citrate cycle (TCA cycle)
    MT7199_0471 (lpdC)
   00620 Pyruvate metabolism
    MT7199_0471 (lpdC)
   00630 Glyoxylate and dicarboxylate metabolism
    MT7199_0471 (lpdC)
   00640 Propanoate metabolism
    MT7199_0471 (lpdC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MT7199_0471 (lpdC)
   00280 Valine, leucine and isoleucine degradation
    MT7199_0471 (lpdC)
   00310 Lysine degradation
    MT7199_0471 (lpdC)
   00380 Tryptophan metabolism
    MT7199_0471 (lpdC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtub04147]
    MT7199_0471 (lpdC)
Enzymes [BR:mtub01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     MT7199_0471 (lpdC)
Exosome [BR:mtub04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MT7199_0471 (lpdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA FAD_binding_3 FAD_binding_2 NAD_binding_8 HI0933_like Thi4 3HCDH_N ApbA DAO
Motif
Other DBs
NCBI-ProteinID: CCG10320
Structure
PDB: 

Position
556874..558268
Genome map
AA seq 464 aa AA seqDB search
MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVH
IFTKDAKAFGISGEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANT
LLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVTYEEQILSRELPKSIIIAGAG
AIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTATKVESIAD
GGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTN
VGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLGDHRMLPRATFCQPNVASFGL
TEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKHGELLGGHLVGHDVAELL
PELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLVGHMINF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgacccactatgacgtcgtcgttctcggagccggtcccggcgggtatgtcgcggcgatt
cgcgccgcacagctcggcctgagcactgcaatcgtcgaacccaagtactggggcggagta
tgcctcaatgtcggctgtatcccatccaaggcgctgttgcgcaacgccgaactggtccac
atcttcaccaaggacgccaaagcatttggcatcagcggcgaggtgaccttcgactacggc
atcgcctatgaccgcagccgaaaggtagccgagggcagggtggccggtgtgcacttcctg
atgaagaagaacaagatcaccgagatccacgggtacggcacatttgccgacgccaacacg
ttgttggttgatctcaacgacggcggtacagaatcggtcacgttcgacaacgccatcatc
gcgaccggcagtagcacccggctggttcccggcacctcactgtcggccaacgtagtcacc
tacgaggaacagatcctgtcccgagagctgccgaaatcgatcattattgccggagctggt
gccattggcatggagttcggctacgtgctgaagaactacggcgttgacgtgaccatcgtg
gaattccttccgcgggcgctgcccaacgaggacgccgatgtgtccaaggagatcgagaag
cagttcaaaaagctgggtgtcacgatcctgaccgccacgaaggtcgagtccatcgccgat
ggcgggtcgcaggtcaccgtgaccgtcaccaaggacggcgtggcgcaagagcttaaggcg
gaaaaggtgttgcaggccatcggatttgcgcccaacgtcgaagggtacgggctggacaag
gcaggcgtcgcgctgaccgaccgcaaggctatcggtgtcgacgactacatgcgtaccaac
gtgggccacatctacgctatcggcgatgtcaatggattactgcagctggcgcacgtcgcc
gaggcacaaggcgtggtagccgccgaaaccattgccggtgcagagactttgacgctgggc
gaccatcggatgttgccgcgcgcgacgttctgtcagccaaacgttgccagcttcgggctc
accgagcagcaagcccgcaacgaaggttacgacgtggtggtggccaagttcccgttcacg
gccaacgccaaggcgcacggcgtgggtgaccccagtgggttcgtcaagctggtggccgac
gccaagcacggcgagctactgggtgggcacctggtcggccacgacgtggccgagctgctg
ccggagctcacgctggcgcagaggtgggacctgaccgccagcgagctggctcgcaacgtc
cacacccacccaacgatgtctgaggcgctgcaggagtgcttccacggcctggttggccac
atgatcaatttctga

DBGET integrated database retrieval system