KEGG   Mycobacterium tuberculosis 7199-99: MT7199_0862Help
Entry
MT7199_0862       CDS       T02617                                 

Definition
(GenBank) putative DEHYDROGENASE
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00010  Glycolysis / Gluconeogenesis
mtub00020  Citrate cycle (TCA cycle)
mtub00620  Pyruvate metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01130  Biosynthesis of antibiotics
mtub01200  Carbon metabolism
Module
mtub_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT7199_0862
   00020 Citrate cycle (TCA cycle)
    MT7199_0862
   00620 Pyruvate metabolism
    MT7199_0862
Enzymes [BR:mtub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     MT7199_0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh
Motif
Other DBs
NCBI-ProteinID: CCG10711
Position
942640..943644
Genome map
AA seq 334 aa AA seqDB search
MTRTSEGLAAFVVDQLEELYRRMWVLRLLDMALEQLRIEGLINGPLQGGFGQEAVSVGAA
AALGEGDVIITTHRPHAQHVGTDAPLGPVIADMLGATAGDLEGADEDAHIADPRAGLPAA
IRVVKQSPLLAIGHAYALWLRDTGRVTLCVTQDCDVDADAFNEAADLAAVWQLPVVILVE
NIRGALSVHLDRYTHEPRVYRRAVAYGMPGVSVDGNDVEAVRDCVANAVVRARAGGGPTL
VQAITYRTTDFSGSDRGGYRDLAGSEQFLDPLIFARRRLIAAGTTRGRLDEQERAACQQV
ADAVAFAKARARPNGGGPISRPTSGWHQQPKTRF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgtaccagtgaagggttggctgcgttcgtggtcgatcagctggaggagctgtat
cgccggatgtgggtgttgcgactgctcgatatggcgttggagcagttgcgcatcgaaggc
ctgatcaacgggccgctgcagggtggcttcggccaggaagcagtaagtgtcggtgccgcg
gcggcgctgggcgaaggcgatgtcatcatcaccacccatcgtccgcatgcccaacacgtt
ggtactgacgctccgctgggcccggtgatcgccgacatgctgggtgcgaccgcaggcgat
ctagaaggcgctgacgaggatgcgcacattgccgatcctcgggccgggctaccggctgca
atacgcgtggtcaagcaatcgccgctgttggctatcggacacgcctacgccctgtggctg
cgcgacaccggacgggtcacactctgcgtgacccaagactgtgatgttgatgccgatgcc
ttcaacgaggccgcggacctagcggccgtgtggcaacttccggtggtgattctcgtcgaa
aacattcgtggtgccctaagtgtgcacctggacaggtacacgcacgagcctcgggtttat
cgccgggctgtggcctacggaatgccgggggtatcggtggacggcaacgacgtcgaagcg
gtccgtgactgtgtggccaacgcggtggttcgggctcgcgctggtggcggccccacgctg
gtccaagccatcacctaccgcaccaccgatttctctggatctgaccgcggcggctatcgc
gacctggccggatccgagcagtttctggatccgctgatcttcgcgagaaggcggctgatt
gctgctggcacgacccgcggtcggctcgacgagcaggagcgggcggcatgccaacaggtg
gccgatgccgtggcgttcgccaaggccagggcgcggcccaacggcggtgggccaatcagc
cgaccaacatccggctggcaccaacaaccaaagacccggttctga

KEGG   Mycobacterium tuberculosis 7199-99: MT7199_2273Help
Entry
MT7199_2273       CDS       T02617                                 

Definition
(GenBank) putative pyruvate dehydrogenase E1 component aceE (PYRUVATE DECARBOXYLASE) (PYRUVATE DEHYDROGENASE) (PYRUVIC DEHYDROGENASE)
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00010  Glycolysis / Gluconeogenesis
mtub00020  Citrate cycle (TCA cycle)
mtub00620  Pyruvate metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01130  Biosynthesis of antibiotics
mtub01200  Carbon metabolism
Module
mtub_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT7199_2273
   00020 Citrate cycle (TCA cycle)
    MT7199_2273
   00620 Pyruvate metabolism
    MT7199_2273
Enzymes [BR:mtub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     MT7199_2273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: CCG12121
Position
2519023..2521728
Genome map
AA seq 901 aa AA seqDB search
MASYLPDIDPEETSEWLESFDTLLQRCGPSRARYLMLRLLERAGEQRVAIPALTSTDYVN
TIPTELEPWFPGDEDVERRYRAWIRWNAAIMVHRAQRPGVGVGGHISTYASSAALYEVGF
NHFFRGKSHPGGGDQVFIQGHASPGIYARAFLEGRLTAEQLDGFRQEHSHVGGGLPSYPH
PRLMPDFWEFPTVSMGLGPLNAIYQARFNHYLHDRGIKDTSDQHVWCFLGDGEMDEPESR
GLAHVGALEGLDNLTFVINCNLQRLDGPVRGNGKIIQELESFFRGAGWNVIKVVWGREWD
ALLHADRDGALVNLMNTTPDGDYQTYKANDGGYVRDHFFGRDPRTKALVENMSDQDIWNL
KRGGHDYRKVYAAYRAAVDHKGQPTVILAKTIKGYALGKHFEGRNATHQMKKLTLEDLKE
FRDTQRIPVSDAQLEENPYLPPYYHPGLNAPEIRYMLDRRRALGGFVPERRTKSKALTLP
GRDIYAPLKKGSGHQEVATTMATVRTFKEVLRDKQIGPRIVPIIPDEARTFGMDSWFPSL
KIYNRNGQLYTAVDADLMLAYKESEVGQILHEGINEAGSVGSFIAAGTSYATHNEPMIPI
YIFYSMFGFQRTGDSFWAAADQMARGFVLGATAGRTTLTGEGLQHADGHSLLLAATNPAV
VAYDPAFAYEIAYIVESGLARMCGENPENIFFYITVYNEPYVQPPEPENFDPEGVLRGIY
RYHAATEQRTNKAQILASGVAMPAALRAAQMLAAEWDVAADVWSVTSWGELNRDGVAIET
EKLRHPDRPAGVPYVTRALENARGPVIAVSDWMRAVPEQIRPWVPGTYLTLGTDGFGFSD
TRPAARRYFNTDAESQVVAVLEALAGDGEIDPSVPVAAARQYRIDDVAAAPEQTTDPGPG
A
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcgtatttgcccgacattgatcccgaggagacctcggagtggctggagtccttt
gacacgctgctgcaacgctgcggcccgtcgcgggcccgctacctgatgttgcggctgcta
gagcgggccggcgagcagcgggtggccatcccggcattgacgtctaccgactatgtcaac
accatcccgaccgagctggagccgtggttccccggcgacgaagacgtcgaacgtcgttat
cgagcgtggatcagatggaatgcggccatcatggtgcaccgtgcgcaacgaccgggtgtg
ggcgtgggtggccatatctcgacctacgcgtcgtccgcggcgctctatgaggtcggtttc
aaccacttcttccgcggcaagtcgcacccgggcggcggcgatcaggtgttcatccagggc
cacgcttccccgggaatctacgcgcgcgccttcctcgaagggcggttgaccgccgagcaa
ctcgacggattccgccaggaacacagccatgtcggcggcgggttgccgtcctatccgcac
ccgcggctcatgcccgacttctgggaattccccaccgtgtcgatgggtttgggcccgctc
aacgccatctaccaggcacggttcaaccactatctgcatgaccgcggtatcaaagacacc
tccgatcaacacgtgtggtgttttttgggcgacggcgagatggacgaacccgagagccgt
gggctggcccacgtcggcgcgctggaaggcttggacaacttgaccttcgtgatcaactgc
aatctgcagcgactcgacggcccggtgcgcggcaacggcaagatcatccaggagctggag
tcgttcttccgcggtgccggctggaacgtcatcaaggtggtgtggggccgcgaatgggat
gccctgctgcacgccgaccgcgacggtgcgctggtgaatttaatgaatacaacacccgat
ggcgattaccagacctataaggccaacgacggcggctacgtgcgtgaccacttcttcggc
cgcgacccacgcaccaaggcgctggtggagaacatgagcgaccaggatatctggaacctc
aaacggggcggccacgattaccgcaaggtttacgccgcctaccgcgccgccgtcgaccac
aagggacagccgacggtgatcctggccaagaccatcaaaggctacgcgctgggcaagcat
ttcgaaggacgcaatgccacccaccagatgaaaaaactgaccctggaagaccttaaggag
tttcgtgacacgcagcggattccggtcagcgacgcccagcttgaagagaatccgtacctg
ccgccctactaccaccccggcctcaacgccccggagattcgttacatgctcgaccggcgc
cgggccctcgggggctttgttcccgagcgcaggaccaagtccaaagcgctgaccctgccg
ggtcgcgacatctacgcgccgctgaaaaagggctctgggcaccaggaggtggccaccacc
atggcgacggtgcgcacgttcaaagaagtgttgcgcgacaagcagatcgggccgcggata
gtcccgatcattcccgacgaggcccgcaccttcgggatggactcctggttcccgtcgcta
aagatctataaccgcaatggccagctgtataccgcggttgacgccgacctgatgctggcc
tacaaggagagcgaagtcgggcagatcctgcacgagggcatcaacgaagccgggtcggtg
ggctcgttcatcgcggccggcacctcgtatgcgacgcacaacgaaccgatgatccccatt
tacatcttctactcgatgttcggcttccagcgcaccggcgatagcttctgggccgcggcc
gaccagatggctcgagggttcgtgctcggggccaccgccgggcgcaccaccctgaccggt
gagggcctgcaacacgccgacggtcactcgttgctgctggccgccaccaacccggcggtg
gttgcctacgacccggccttcgcctacgaaatcgcctacatcgtggaaagcggactggcc
aggatgtgcggggagaacccggagaacatcttcttctacatcaccgtctacaacgagccg
tacgtgcagccgccggagccggagaacttcgatcccgagggcgtgctgcggggtatctac
cgctatcacgcggccaccgagcaacgcaccaacaaggcgcagatcctggcctccggggta
gcgatgcccgcggcgctgcgggcagcacagatgctggccgccgagtgggatgtcgccgcc
gacgtgtggtcggtgaccagttggggcgagctaaaccgcgacggggtggccatcgagacc
gagaagctccgccaccccgatcggccggcgggcgtgccctacgtgacgagagcgctggag
aatgctcggggcccggtgatcgcggtgtcggactggatgcgcgcggtccccgagcagatc
cgaccgtgggtgccgggcacatacctcacgttgggcaccgacgggttcggcttttccgac
actcggcccgccgctcgccgctacttcaacaccgacgccgaatcccaggtggtcgcggtt
ttggaggcgttggcgggcgacggcgagatcgacccatcggtgccggtcgcggccgcccgc
cagtaccggatcgacgacgtggcggctgcgcccgagcagaccacggatcccggtcccggg
gcctaa

KEGG   Mycobacterium tuberculosis 7199-99: MT7199_2527Help
Entry
MT7199_2527       CDS       T02617                                 

Definition
(GenBank) putative PYRUVATE DEHYDROGENASE E1 COMPONENT (BETA SUBUNIT) PDHB (PYRUVATE DECARBOXYLASE) (PYRUVATE DEHYDROGENASE) (PYRUVIC DEHYDROGENASE)
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00010  Glycolysis / Gluconeogenesis
mtub00020  Citrate cycle (TCA cycle)
mtub00620  Pyruvate metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01130  Biosynthesis of antibiotics
mtub01200  Carbon metabolism
Module
mtub_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT7199_2527
   00020 Citrate cycle (TCA cycle)
    MT7199_2527
   00620 Pyruvate metabolism
    MT7199_2527
Enzymes [BR:mtub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     MT7199_2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-ProteinID: CCG12375
Position
complement(2810550..2811596)
Genome map
AA seq 348 aa AA seqDB search
MTQIADRPARPDETLAVAVSDITQSLTMVQAINRALYDAMAADERVLVFGEDVAVEGGVF
RVTEGLADTFGADRCFDTPLAESAIIGIAVGLALRGFVPVPEIQFDGFSYPAFDQVVSHL
AKYRTRTRGEVDMPVTVRIPSFGGIGAAEHHSDSTESYWVHTAGLKVVVPSTPGDAYWLL
RHAIACPDPVMYLEPKRRYHGRGMVDTSRPEPPIGHAMVRRSGTDVTVVTYGNLVSTALS
SADTAEQQHDWSLEVIDLRSLAPLDFDTIAASIQRTGRCVVMHEGPRSLGYGAGLAARIQ
EEMFYQLEAPVLRACGFDTPYPPARLEKLWLPGPDRLLDCVERVLRQP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaatcgcagaccgtccggccaggccggatgagacgcttgcggtagcggtgagc
gacatcacgcagtcgttgaccatggtccaggcgatcaaccgcgccctgtacgacgcgatg
gccgccgacgagcgggtattggtgtttggcgaggatgtcgcggtcgagggtggggtgttt
cgggtgaccgagggactggccgatacgttcggtgcagaccggtgcttcgacacgccactg
gcggagtccgcgatcatcggaatagccgtcgggttggcactacgtggctttgtgccggtg
ccagaaatccagttcgacggcttttcctatccggctttcgaccaagtggtgagccatctg
gccaagtaccggactcgcacccgcggtgaggtggacatgccggtgaccgtccggatcccc
tcgtttggcggtatcggtgcggccgaacatcattcggactccacggagtcctactgggtg
cacaccgcgggcctcaaggtggtggtgccgtcgacacccggtgacgcttactggctgctg
cggcacgctatcgcctgcccggaccccgtgatgtatctggagcccaaacgccgctaccac
ggccgcgggatggtcgacactagccggccggaaccgccgatcgggcacgcgatggtgcgc
cggtccggcaccgatgtgaccgtggtaacgtacggaaacctggtgagcaccgccctgtct
agcgcggatactgcagagcagcaacatgattggagtctggaggttatcgatctgcggtcg
ttggcgccgctggacttcgacaccattgctgcgtcgatccagcgcaccgggcgttgcgtg
gtgatgcacgaagggccgcgcagcctcggctatggtgccggtctggccgcgcgcatccag
gaagagatgttctaccaattggaggctccggtgttgcgtgcctgcggttttgacacaccc
tacccgcctgcgcggttggaaaaattgtggttacccggccccgaccggctgttggactgc
gtcgaacgtgtgctgcgtcagccatga

KEGG   Mycobacterium tuberculosis 7199-99: MT7199_2528Help
Entry
MT7199_2528       CDS       T02617                                 

Definition
(GenBank) putative PYRUVATE DEHYDROGENASE E1 COMPONENT (ALPHA SUBUNIT) PDHA (PYRUVATE DECARBOXYLASE) (PYRUVATE DEHYDROGENASE) (PYRUVIC DEHYDROGENASE)
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00010  Glycolysis / Gluconeogenesis
mtub00020  Citrate cycle (TCA cycle)
mtub00620  Pyruvate metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01130  Biosynthesis of antibiotics
mtub01200  Carbon metabolism
Module
mtub_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT7199_2528
   00020 Citrate cycle (TCA cycle)
    MT7199_2528
   00620 Pyruvate metabolism
    MT7199_2528
Enzymes [BR:mtub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     MT7199_2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C Transketolase_N
Motif
Other DBs
NCBI-ProteinID: CCG12376
Position
complement(2811607..2812710)
Genome map
AA seq 367 aa AA seqDB search
MGEGSRRPSGMLMSVDLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTE
FVNLQRQGELALYTPCRGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAW
RGTWHGGLQFTTKCCAPMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVH
EALNFAAVFTTPCVFYVQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACY
AVMAEAAARARAGDGPTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYL
QDQGLWSQRLEEQVTARAKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQREQLR
AELARTD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggggagggttctcggaggccatctgggatgttgatgtctgtcgatcttgagccggtg
caactcgtcggcccggacggtacgccgacggccgaacgccgctaccaccgtgaccttcct
gaggaaacgctgcgttggctctacgagatgatggtggtcacccgcgagctggataccgaa
ttcgtcaatctgcagcgccagggggagctggcgttgtacacgccctgtcgcgggcaggaa
gccgcgcaggtgggtgcggcggcttgcctacgcaaaaccgactggttgttcccccaatac
cgagaattgggcgtctacctagtgcgtggcatcccgcctggacatgttggggtcgcgtgg
cgtggaacctggcacggcgggctgcaattcaccacgaagtgctgtgcaccgatgtcggtt
cccatcggcacccagaccttgcacgcggtgggcgcggcgatggccgcgcaacgcctggac
gaggactccgtgacggtggcctttctgggcgacggcgccaccagcgagggcgacgtacat
gaggcgctcaatttcgcggcggtgttcaccacaccgtgcgtgttctacgtgcagaacaac
cagtgggcaatctcgatgccggtatccaggcagaccgccgcaccatctatcgcgcacaag
gcgattggctacgggatgccaggcatccgggtggacggcaacgacgtgctggcatgctat
gcggtgatggccgaagctgccgctcgggctcgggccggcgacggtccaacgctgatcgag
gcggtcacttaccgtcttggtccgcacaccaccgccgatgatccaacccggtaccgcagc
caggaggaggtggaccgctgggcgacgctggacccgattccgcgctatcgcacttactta
caagatcagggcctgtggtcgcaacgcctcgaggaacaggtgacggctcgggcaaaacac
gtgcggtccgagctacgcgacgcggtctttgatgcgcctgacttcgacgtcgatgaggtg
ttcaccacggtgtacgccgaaatcacacccgggttgcaggcgcagcgcgaacagctgcgt
gccgaactggcgcggactgactga

DBGET integrated database retrieval system