KEGG   Mycobacterium tuberculosis 7199-99: MT7199_2384Help
Entry
MT7199_2384       CDS       T02617                                 

Gene name
plcA
Definition
(GenBank) putative MEMBRANE-ASSOCIATED PHOSPHOLIPASE C 1 PLCA (MTP40 ANTIGEN)
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00562  Inositol phosphate metabolism
mtub00564  Glycerophospholipid metabolism
mtub00565  Ether lipid metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MT7199_2384 (plcA)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MT7199_2384 (plcA)
   00565 Ether lipid metabolism
    MT7199_2384 (plcA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MT7199_2384 (plcA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mtub02042]
    MT7199_2384 (plcA)
Enzymes [BR:mtub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     MT7199_2384 (plcA)
Bacterial toxins [BR:mtub02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   MT7199_2384 (plcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: CCG12232
Position
complement(2633044..2634582)
Genome map
AA seq 512 aa AA seqDB search
MSRREFLTKLTGAGAAAFLMDWAAPVIEKAYGAGPCPGHLTDIEHIVLLMQENRSFDHYF
GTLSSTNGFNAASPAFQQMGWNPMTQALDPAGVTIPFRLDTTRGPFLDGECVNDPEHQWV
GMHLAWNGGANDNWLPAQATTRAGPYVPLTMGYYTRQDIPIHYLLADTFTICDGYHCSLL
TGTLPNRLYWLSANIDPAGTDGGPQLVEPGFLPLQQFSWRIMPENLEDAGVSWKVYQNKG
LGRFINTPISNNGLVQAFRQAADPRSNLARYGIAPTYPGDFAADVRANRLPKVSWLVPNI
LQSEHPALPVALGAVSMVTALRILLSNPAVWEKTALIVSYDENGGFFDHVTPPTAPPGTP
GEFVTVPNIDAVPGSGGIRGPLGLGFRVPCIVISPYSRGPLMVSDTFDHTSQLKLIRARF
GVPVPNMTAWRDGVVGDMTSAFNFATPPNSTRPNLSHPLLGALPKLPQCIPNVVLGTTDG
ALPSIPYRVPYPQVMPTQETTPVRGTPSGLCS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtcgagagtttttgacaaagctcactggcgcaggcgcagcggcattcctgatg
gactgggctgcaccggtgattgaaaaggcctacggcgccgggccttgtcccggacatttg
accgacatcgagcatatcgtgttgctgatgcaggagaaccggtcattcgaccactatttc
ggaacgctttccagcaccaatgggttcaacgccgcgtcgccggcattccaacaaatgggt
tggaaccccatgacgcaggcgttggaccccgccggggtcaccattccgttccgcttggac
accacccgaggccccttcctggacggcgagtgcgtcaacgaccccgagcaccagtgggtg
gggatgcacctggcctggaacggtggtgccaacgacaactggctgccggcgcaggcgacc
acccgcgcaggaccatatgtccctttgaccatgggttactacacgcgccaagacatcccg
atccactatctgctggccgacacgttcaccatctgcgacggctaccattgctcgctgctg
acgggcaccctgcccaaccggctctactggttgagcgccaacatcgaccccgccggcacc
gacgggggaccccaattggtagagccgggcttcctgccgctgcagcaattcagttggcgc
atcatgccggaaaacctcgaagatgccggggtcagctggaaggtgtaccagaacaagggc
ctcgggcgattcatcaacacgcccatcagcaataacgggctggtgcaggccttccgccag
gcagctgatccgaggtcgaacttggcccgctacggtatcgccccgacctaccctggggac
ttcgctgccgacgtcagggccaaccggctacccaaggtctcctggttagttcccaacatc
ctgcagtccgaacaccccgccctgccggtagcgcttggcgcggtgtccatggtgaccgcg
ctgcggatcttgctgtccaatcccgcggtgtgggaaaagaccgcacttatcgtcagctat
gacgagaacggcggcttcttcgaccacgtcacgccccccacggcaccgcccgggacaccc
ggcgaattcgtcacggtgcccaacatcgacgcagtacccgggtccggtggcattcgtggt
ccgctcggtctgggttttcgcgttccctgcattgtcatttcgccgtacagccgcggcccg
ctgatggtctccgacacgttcgaccacacctcgcaattgaagttgattcgcgcccggttc
ggcgtgccggttcccaacatgaccgcctggcgcgacggcgtggttggcgacatgacctca
gcgttcaactttgcgactccaccgaattcgaccagacccaacttgagccacccgttgctg
ggagcgctgccgaagctgccgcagtgcatccctaacgtggtgttgggaaccaccgacggc
gcgttgccgagcattccctatcgggtgccctatccgcaggtgatgccaactcaggaaacc
acacccgtccgcgggactcccagcgggctgtgcagctga

DBGET integrated database retrieval system