KEGG   Mycobacterium tuberculosis 7199-99: MT7199_2487Help
Entry
MT7199_2487       CDS       T02617                                 

Definition
(GenBank) putative OXIDOREDUCTASE (BETA SUBUNIT)
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00010  Glycolysis / Gluconeogenesis
mtub00020  Citrate cycle (TCA cycle)
mtub00620  Pyruvate metabolism
mtub00650  Butanoate metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01130  Biosynthesis of antibiotics
mtub01200  Carbon metabolism
Module
mtub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtub_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT7199_2487
   00020 Citrate cycle (TCA cycle)
    MT7199_2487
   00620 Pyruvate metabolism
    MT7199_2487
   00650 Butanoate metabolism
    MT7199_2487
Enzymes [BR:mtub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     MT7199_2487
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     MT7199_2487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: CCG12335
Position
complement(2755599..2756720)
Genome map
AA seq 373 aa AA seqDB search
MTRSGDEAQLMTGVTGDLAGTELGLTPSLTKNAGVPTTDQPQKGKDFTSDQEVRWCPGCG
DYVILNTIRNFLPELGLRRENIVFISGIGCSSRFPYYLETYGFHSIHGRAPAIATGLALA
REDLSVWVVTGDGDALSIGGNHLIHALRRNINVTILLFNNRIYGLTKGQYSPTSEVGKVT
KSTPMGSLDHPFNPVSLALGAEATFVGRALDSDRNGLTEVLRAAAQHRGAALVEILQDCP
IFNDGSFDALRKEGAEERVIKVRHGEPIVFGANGEYCVVKSGFGLEVAKTADVAIDEIIV
HDAQVDDPAYAFALSRLSDQNLDHTVLGIFRHISRPTYDDAARSQVVAARNAAPSGTAAL
QSLLHGRDTWTVD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacccgctccggcgatgaagcacagctcatgaccggcgtgaccggtgatttggcgggc
accgagctcggcctgactccgagcttgaccaagaacgctggggtgcccaccacggatcag
ccgcagaagggcaaggatttcaccagtgaccaggaggtgcgctggtgcccgggctgcggc
gactacgtcatcctcaacaccatccgaaacttcctgcccgaactggggctgcggcgtgag
aacatcgtgttcatcagcggtatcggatgctccagccggttcccctattacctggaaacc
tacggctttcattcgattcacggccgcgcgcccgcgatagcgaccggtctggcgctggct
cgcgaggatctgtcggtatgggtggtcaccggcgacggtgacgccttgtcgatcggcggt
aaccacctgatccacgcgctgcgccgcaacatcaacgtgacgattctgctgttcaacaac
cggatctatgggctgaccaaaggacagtattcgccgacatcggaggtcggcaaggtcacc
aagtcgacaccgatgggctcgctggatcacccgttcaatccggtgtcgttggcgctgggg
gcagaggcgacgttcgttggccgcgcgctggactcagaccgtaacgggctgaccgaagtg
ctgcgtgccgcggcccagcatcgcggtgctgccctggtcgaaatcctgcaggactgcccg
atcttcaacgacggctcgttcgatgcgctgcgcaaggagggcgccgaggagcgggtcatc
aaggtccgccacggcgagccgatcgtcttcggggccaacggcgaatactgcgtggtcaag
tccggattcggcctcgaagtggccaagacggccgatgtggccatcgacgagatcattgtg
cacgatgcgcaggtcgacgacccggcctacgccttcgcgctgtcccggctgtccgatcag
aacctggaccacaccgtgctgggaatctttcggcacatcagccggccaacctacgatgat
gcggcccgctcgcaggtagtcgcggcccgaaacgccgccccgtccggcaccgctgcactg
cagtcactgttgcacgggcgcgacacttggaccgtcgactga

KEGG   Mycobacterium tuberculosis 7199-99: MT7199_2488Help
Entry
MT7199_2488       CDS       T02617                                 

Definition
(GenBank) putative OXIDOREDUCTASE (ALPHA SUBUNIT)
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00010  Glycolysis / Gluconeogenesis
mtub00020  Citrate cycle (TCA cycle)
mtub00620  Pyruvate metabolism
mtub00650  Butanoate metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01130  Biosynthesis of antibiotics
mtub01200  Carbon metabolism
Module
mtub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtub_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT7199_2488
   00020 Citrate cycle (TCA cycle)
    MT7199_2488
   00620 Pyruvate metabolism
    MT7199_2488
   00650 Butanoate metabolism
    MT7199_2488
Enzymes [BR:mtub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     MT7199_2488
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     MT7199_2488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N POR PFOR_II TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: CCG12336
Position
complement(2756717..2758678)
Genome map
AA seq 653 aa AA seqDB search
MDPNGSGAGPESHDAAFHAAPDRQRLENVVIRFAGDSGDGMQLTGDRFTSEAALFGNDLA
TQPNYPAEIRAPAGTLPGVSSFQIQIADYDILTAGDRPDVLVAMNPAALKANIGDLPLGG
MVIVNSDEFTKRNLTKVGYVTNPLESGELSDYVVHTVAMTTLTLGAVEAIGASKKDGQRA
KNMFALGLLSWMYGRELEHSEAFIREKFARKPEIAEANVLALKAGWNYGETTEAFGTTYE
IPPATLPPGEYRQISGNTALAYGIVVAGQLAGLPVVLGSYPITPASDILHELSKHKNFNV
VTFQAEDEIGGICAALGAAYGGALGVTSTSGPGISLKSEALGLGVMTELPLLVIDVQRGG
PSTGLPTKTEQADLLQALYGRNGESPVAVLAPRSPADCFETALEAVRIAVSYHTPVILLS
DGAIANGSEPWRIPDVNALPPIKHTFAKPGEPFQPYARDRETLARQFAIPGTPGLEHRIG
GLEAANGSGDISYEPTNHDLMVRLRQAKIDGIHVPDLEVDDPTGDAELLLIGWGSSYGPI
GEACRRARRRGTKVAHAHLRYLNPFPANLGEVLRRYPKVVAPELNLGQLAQVLRGKYLVD
VQSVTKVKGVSFLADEIGRFIRAALAGRLAELEQDKTLVARLSAATAGAGANG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtggatccgaacggcagcggggccgggccagagtctcatgacgcggcatttcatgccgcg
cctgatcggcaacgcttggaaaatgtggtgatccggttcgctggagactccggcgacggc
atgcagctaaccggcgaccgattcacctcggaggcagcgcttttcggcaacgatctggcg
acccagccgaactaccccgcagagatccgggcaccggcgggcacgttgcccggagtgtcg
tcttttcagattcagatagccgattacgacatcctgaccgccggtgaccgtcccgacgtg
ctcgtcgccatgaacccggcagcgttgaaggccaatatcggcgacctaccgcttggcgga
atggtgatcgtgaactctgacgagttcaccaagcgcaacctgacgaaagtgggctacgtg
acaaacccgctggagtccggcgagctgtccgactatgtggtgcacaccgtcgccatgacc
acactgaccctgggtgccgtcgaggcgatcggcgcgtccaagaaggatggccagcgcgcc
aaaaatatgtttgcgctgggtctgctgtcgtggatgtacgggcgcgagctcgagcacagc
gaggccttcatcagggagaagttcgcccgcaagcccgaaatcgccgaggccaacgtgttg
gccctcaaggccggctggaactacggcgaaaccaccgaggccttcggcacgacctatgag
ataccgcccgcgactttgccgcccggcgagtaccggcagatctcgggcaataccgcgctg
gcctacgggatcgtggtggccggtcagctcgccggccttccggtcgtgctcggcagttat
ccgattactccggcgtcggacatcctgcacgaactgtccaagcacaagaacttcaatgtc
gtcaccttccaggccgaagacgagatcggcggcatctgcgctgcgctgggtgccgcctac
ggtggtgcgttgggagtcaccagcacatcgggaccgggaatttcgctgaagtccgaagcg
ctgggactgggtgtgatgaccgaactgccgttgctggtcatagacgtgcagcggggcggg
ccgtcgaccggtctacccaccaagaccgagcaggccgacttgctgcaggcgctctacggc
cgcaatggcgagtcaccggtggcggtgctggcgccgcgctctcctgccgactgctttgaa
accgcccttgaggcggtgcgcatcgcggtgtcctaccacaccccggtgatcttgttgtcc
gacggcgccatcgccaacggctcggagccatggcgaatcccggatgtcaatgcgctaccg
cccattaagcacaccttcgccaaacccggcgagcccttccagccttatgcccgtgaccgg
gaaacccttgcccgccagttcgccattccgggcacccccggtctggaacaccgcatcggc
gggctggaagctgccaatggctcgggcgacatctcctacgagccgactaatcatgacctc
atggtccggttgcgccaagccaagatcgacggtatccatgttcccgatctggaagtcgat
gatccgaccggggacgccgagctgttgttgatcgggtggggcagctcctacggcccaatc
ggtgaagcgtgccggcgcgcgcgtcgccgaggcaccaaggtagcgcacgcccatctgcgc
tatctcaacccgttcccggccaatttgggtgaggtgctgcggcgttaccccaaggtggtg
gctccggagttgaacttgggccagctggcccaggtgctgcgcggtaagtacctggtcgac
gtgcaatcggtcaccaaggttaagggtgtctcgttcctggccgacgagattgggcgcttt
atccgggccgcacttgccgggagattggccgagcttgagcaagacaagacgttggtcgcc
agattgtcggcggccacggcgggagcgggagcaaacggatga

DBGET integrated database retrieval system