KEGG   Mycobacterium tuberculosis 7199-99: MT7199_2526Help
Entry
MT7199_2526       CDS       T02617                                 

Definition
(GenBank) putative DIHYDROLIPOAMIDE S-ACETYLTRANSFERASE E2 COMPONENT PDHC (LIPOATE ACETYLTRANSFERASE) (THIOLTRANSACETYLASE A)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00010  Glycolysis / Gluconeogenesis
mtub00020  Citrate cycle (TCA cycle)
mtub00620  Pyruvate metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01130  Biosynthesis of antibiotics
mtub01200  Carbon metabolism
Module
mtub_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT7199_2526
   00020 Citrate cycle (TCA cycle)
    MT7199_2526
   00620 Pyruvate metabolism
    MT7199_2526
Enzymes [BR:mtub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MT7199_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 Ribosomal_L13
Motif
Other DBs
NCBI-ProteinID: CCG12374
Structure
PDB: 

Position
complement(2809372..2810553)
Genome map
AA seq 393 aa AA seqDB search
MSGEDSIRSFPVPDLGEGLQEVTVTCWSVAVGDDVEINQTLCSVETAKAEVEIPSPYAGR
IVELGGAEGDVLKVGAELVRIDTGPTAVAQPNGEGAVPTLVGYGADAAIETSRRTSRPLA
APVVRKLAKELAVDLAALQRGSGAGGVITRADVLAAARGGVGAGPDVRPVHGVHARMAEK
MTLSHKEIPTAKASVEVICAELLRLRDRFVSAAPEITPFALTLRLLVIALKHNVILNSTW
VDSGEGPQVHVHRGVHLGFGAATERGLLVPVVTDAQDKNTRELASRVAELITGAREGTLT
PAELRGSTFTVSNFGALGVDDGVPVINHPEAAILGLGAIKPRPVVVGGEVVARPTMTLTC
VFDHRVVDGAQVAQFMCELRDLIESPETALLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaggacagcatcaggtctttcccggtgcccgacctcggcgagggactgcag
gaagtgacggtgacgtgttggagcgtcgccgtcggcgacgatgtggagatcaaccagacg
ctgtgttcggtggagaccgccaaggccgaggtcgaaatccccagcccgtatgccggccgg
atcgtcgagttaggcggcgccgaaggcgatgtgctcaaagtgggcgcggagctagttcgg
atcgacaccgggcccacggcagttgcgcagcctaacggtgaaggagcggtccccacgttg
gtcggctacggtgccgacgccgcgatcgaaaccagtagacggacaagccggccgctggcg
gcaccggtagtgcgcaagctggccaaagagttggcggtcgacctggccgcattgcagcgt
gggtcgggcgccggcggtgtgatcacccgggccgatgtgctggccgctgctcgaggcggc
gtcggagccgggccggacgtgcggccggtccacggcgtgcacgcgcggatggccgaaaaa
atgacgttgtcccacaaggagattccgaccgcaaaggccagcgttgaggtaatttgcgcc
gaactgctgcggctgcgcgaccggttcgtttcggcggcgcccgagattacaccgttcgcg
ctgacgctgcggctgctggttattgcattgaaacacaacgtaattctcaactcgacgtgg
gtcgactcgggcgaaggcccgcaagtacacgtgcatcgcggtgtgcatctggggttcggc
gcggccactgagcgtggattgctggtgccggtggtgaccgacgcccaggacaagaacacc
cgcgaacttgcctcccgcgtagcggaattaatcaccggcgcacgtgaaggcactctcaca
cccgcggagctgcgcggttcgacgttcacggtgtcgaacttcggggcgctgggagtcgac
gacggcgtgccggtgatcaaccatcccgaagcggcgatcctgggtctgggggcgatcaag
ccgcgcccggtggtcgtcggcggcgaggttgtcgcacggccgacgatgacgttgacttgt
gtgttcgaccaccgcgttgtcgatggtgctcaggtggcccagttcatgtgtgagctgcgg
gatctgatcgagtcgccggagaccgcgctgttggatctgtag

DBGET integrated database retrieval system