KEGG   Mycobacterium tuberculosis 7199-99: MT7199_2884Help
Entry
MT7199_2884       CDS       T02617                                 

Gene name
mqo
Definition
(GenBank) putative MALATE:QUINONE OXIDOREDUCTASE MQO (MALATE DEHYDROGENASE [ACCEPTOR])
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00020  Citrate cycle (TCA cycle)
mtub00620  Pyruvate metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01130  Biosynthesis of antibiotics
mtub01200  Carbon metabolism
Module
mtub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtub_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MT7199_2884 (mqo)
   00620 Pyruvate metabolism
    MT7199_2884 (mqo)
Enzymes [BR:mtub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     MT7199_2884 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCG12732
Position
complement(3158041..3159522)
Genome map
AA seq 493 aa AA seqDB search
MSDLARTDVVLIGAGIMSATLGVLLRRLEPNWSITLIERLDAVAAESSGPWNNAGTGHSA
LCEMNYTPEMPDGSIDITKAVRVNEQFQVTRQFWAYAAENGILTDVRSFLNPVPHVSFVH
GSRGVEYLRRRQKALAGNPLFAGTEFIESPDEFARRLPFMAAKRAFSEPVALNWAADGTD
VDFGALAKQLIGYCVQNGTTALFGHEVRNLSRQSDGSWTVTMCNRRTGEKRKLNTKFVFV
GAGGDTLPVLQKSGIKEVKGFAGFPIGGRFLRAGNPALTASHRAKVYGFPAPGAPPLGAL
HLDLRFVNGKSWLVFGPYAGWSPKFLKHGQISDLPRSIRPDNLLSVLGVGLTERRLLNYL
ISQLRLSEPERVSALREFAPSAIDSDWELTIAGQRVQVIRRDERNGGVLEFGTTVIGDAD
GSIAGLLGGSPGASTAVAIMLDVLQKCFANRYQSWLPTLKEMVPSLGVQLSNEPALFDEV
WSWSTKALKLGAA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagacctagccagaaccgacgtcgtgctgatcggtgcgggcatcatgagcgccacg
ctgggggtgctgctgcgtcggctcgaaccgaactggtcaatcaccctgatcgaacggctg
gacgcggtagccgccgaaagcagcggtccctggaacaacgccggcaccgggcactccgcg
ctgtgcgagatgaactacaccccagaaatgccggacggctcgatcgacatcaccaaagcg
gtgcgtgtcaacgagcaattccaggtcacccgccagttctgggcatacgcggccgaaaac
ggcatcctcaccgacgtgcgcagcttcctcaaccctgtgccgcacgtgagtttcgtccat
ggatcgcggggcgtcgagtatctacggcgccgccaaaaggcgttggccggcaacccgctg
ttcgccggcaccgagttcatcgagagtcccgacgaattcgcccgccggctgccgttcatg
gccgctaaacgggccttctccgagccggtggcgctcaactgggccgccgacggcaccgac
gtcgacttcggtgccctcgccaaacaactcatcggctattgcgtgcaaaatggcactacc
gcgttgttcgggcacgaggttcgcaacctctcgcggcaatccgacggcagctggacggtc
accatgtgcaaccgccggaccggcgaaaagcgcaagttgaacaccaagttcgtctttgtc
ggggccgggggtgacaccttgccggtgctgcagaaatccgggatcaaagaggtcaaaggc
ttcgccggcttcccgattggcggtcggttcctgcgcgccgggaacccggcgctcaccgcc
tcgcatcgggcaaaggtatatggcttcccggcgccgggcgccccgccgttgggcgccttg
catctggatctgcggtttgtcaacggcaagtcgtggctggtgttcgggccatacgccggc
tggtcgccgaagttcttgaaacacgggcagatcagcgacctgccccggtcgatcaggccg
gacaatctgttgtccgtgctcggcgtgggcctcaccgagcggagactgctgaactacttg
atcagccagctgcgtctctctgaacccgagcgggtcagtgcgctgcgcgaattcgcccct
agcgcaatcgattcggactgggagttgacgatagccggtcagcgggtacaggtgatccgg
cgagatgaacgcaacggcggggtgctcgagttcggcacgacggtcatcggcgatgctgac
ggtagtattgccggactactgggcggctccccaggggcttcgaccgcggtggcgatcatg
ctggacgtgctgcagaaatgctttgccaaccgctatcaatcctggctgcccacgctcaaa
gaaatggtgccgtcgctgggggtgcagctgtcgaatgaacccgcgctgttcgacgaggtg
tggtcatggagcaccaaggcgctgaagttaggtgccgcatga

DBGET integrated database retrieval system