KEGG   Mycobacterium tuberculosis 7199-99: MT7199_3584Help
Entry
MT7199_3584       CDS       T02617                                 

Gene name
ltp3b
Definition
(GenBank) putative LIPID CARRIER protein OR KETO ACYL-COA THIOLASE LTP3
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00071  Fatty acid degradation
mtub00072  Synthesis and degradation of ketone bodies
mtub00280  Valine, leucine and isoleucine degradation
mtub00310  Lysine degradation
mtub00362  Benzoate degradation
mtub00380  Tryptophan metabolism
mtub00620  Pyruvate metabolism
mtub00630  Glyoxylate and dicarboxylate metabolism
mtub00640  Propanoate metabolism
mtub00650  Butanoate metabolism
mtub00900  Terpenoid backbone biosynthesis
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01130  Biosynthesis of antibiotics
mtub01200  Carbon metabolism
mtub01212  Fatty acid metabolism
mtub02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MT7199_3584 (ltp3b)
   00630 Glyoxylate and dicarboxylate metabolism
    MT7199_3584 (ltp3b)
   00640 Propanoate metabolism
    MT7199_3584 (ltp3b)
   00650 Butanoate metabolism
    MT7199_3584 (ltp3b)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MT7199_3584 (ltp3b)
   00072 Synthesis and degradation of ketone bodies
    MT7199_3584 (ltp3b)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MT7199_3584 (ltp3b)
   00310 Lysine degradation
    MT7199_3584 (ltp3b)
   00380 Tryptophan metabolism
    MT7199_3584 (ltp3b)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MT7199_3584 (ltp3b)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MT7199_3584 (ltp3b)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MT7199_3584 (ltp3b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtub04147]
    MT7199_3584 (ltp3b)
Enzymes [BR:mtub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MT7199_3584 (ltp3b)
Exosome [BR:mtub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MT7199_3584 (ltp3b)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCG13432
Position
3969279..3969974
Genome map
AA seq 231 aa AA seqDB search
MVAVKDRLNGSRNPLAHLQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEI
ADARLAQGHPVAWIHGTALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAA
EIYVPFSWFEPMWLENLGFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLI
RFAEAAIQVMGKAEARQVPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggttgcggtcaaggaccggctcaacggcagccgcaacccgttggcacatctgcagcag
cccgacatcaccctggagaaggtgatggcatctcagatgctctgggatccaatacgtttc
gatgagacgtgcccgtcgtcagacggtgcgtgcgcggttgtcgtcggcgacgaggagatc
gccgacgcgcgactggcgcaagggcatccggtggcctggattcatggcaccgcattacgc
accgagccgctggctttcgccgggcgcgaccaggtcaacccgcaggccggccgcgacgcg
gcggcggcgctgtggaaggccgcgggcatcaccagccccatcgacgaaatcgacgccgcc
gaaatttacgtcccgttctcctggttcgagccgatgtggttggagaatctgggatttgcc
cgcgagggcgagggctggaagctcaccgaggccggcgagactgcgatcggcggtcgacta
ccggtgaacccttccggcggcgtgctgtccgccaatccgatcggcgcatcgggcctgatc
cgcttcgccgaggccgcgatccaagtcatgggcaaggcggaggcgcgtcaagttccgggt
gcgcgaaaggccttggggcacgcttacggtggcggctcgcagtacttctctatgtgggtg
gtcggctgcgagaaacccaaacaggcagccgcataa

DBGET integrated database retrieval system