KEGG   Mycobacterium tuberculosis 7199-99: MT7199_3628Help
Entry
MT7199_3628       CDS       T02617                                 

Definition
(GenBank) ARYLAMINE N-ACETYLTRANSFERASE NAT (ARYLAMINE ACETYLASE)
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00983  Drug metabolism - other enzymes
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    MT7199_3628
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MT7199_3628
   00983 Drug metabolism - other enzymes
    MT7199_3628
Enzymes [BR:mtub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     MT7199_3628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: CCG13476
Structure
PDB: 

Position
complement(4016592..4017443)
Genome map
AA seq 283 aa AA seqDB search
MALDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADK
LVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGS
GGCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFT
TQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLA
DAAAVVDTLSERFGINVADIGERGALETRIDELLARQPGADAP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcactggatctgaccgcgtacttcgatcgcatcaactatcgcggcgctaccgatcca
accctggatgttctgcaggatctggtgaccgtgcacagtcgaacgattccgttcgagaac
ctcgacccgctgctgggggtgccggtcgacgacctcagtccacaggcgctggccgacaag
ctggtacttcggcgccgaggcgggtactgctttgagcacaacgggctgatgggttatgtg
ctggccgaactcggctatcgggtgcgccgattcgccgcccgcgtcgtctggaagctcgcg
ccggacgcgcccctgccgccgcagacgcacaccctgctgggggtcacgttccccggctcg
ggcggatgctatctcgtcgacgtcggattcggcggccaaacaccgacctcaccgcttcgc
ctcgaaaccggcgccgtccagccgacaacgcacgaaccttatcggctcgaggaccgcgtc
gacggctttgtcttacaggcgatggtccgggacacatggcagacactgtacgaattcacc
acccagacccgcccgcagatcgatctgaaagtggccagctggtacgcctcaacacacccg
gcatcgaagttcgtcacgggactgaccgccgcggtgatcaccgacgacgcccggtggaac
ctatctggccgcgaccttgccgttcaccgtgccggtggtaccgagaagatccgccttgcc
gatgcggcagcggttgtcgacaccctgagcgaacggttcgggatcaacgtggcagatatc
ggcgagcgcggcgcgctcgagacgcgcatcgacgagctattggctcggcagccaggagcc
gatgcgccgtaa

DBGET integrated database retrieval system