KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_03390Help
Entry
J113_03390        CDS       T02652                                 

Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    J113_03390
Enzymes [BR:mtuc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     J113_03390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AGL25950
UniProt: R4M5B1
Position
complement(567436..568152)
Genome map
AA seq 238 aa AA seqDB search
MCRLGVPLRQVAEPVDGPWANGVRRIATEAGITVIAGMFTPTGDGRVTNTLIAAGPGTPN
QPDAHYHKIHLYDAFGFTESRTVAPGREPVVVVVDGVRVGLTVCYDIRFPALYTELARRG
AQLIAVCASWGSGPGKLEQWTLLARARALDSMSYVAAAGQADPGDARTGVGASSAAPTGV
GGSLVASPLGEVVVSAGTQPQLLVADIDVDNVAAARDRIAVLRNQTDFVQIDKAQSRG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtgccggctcggtgtcccgctgcggcaggtcgccgagcccgtcgacggaccctgggca
aacggagtccgacggatcgcgaccgaggcgggcatcaccgtgatcgccggcatgttcacc
ccgaccggcgacgggcgggtaacaaacacgctgatcgcagccggcccgggcacgcccaat
cagccggacgcgcactaccacaagatccacctctatgacgcgttcggcttcaccgagtca
cgtaccgtcgcacccgggcgcgaaccggtggtagtcgtggtcgacggcgtgcgggtgggt
ttgaccgtttgctacgacattcgctttcccgccctttataccgagctggcgcggcgcggg
gcccaactgatcgcggtctgtgcatcctggggttccggtccgggcaaactcgaacagtgg
acgttgctggcccgcgcccgggcgctagactccatgagttacgtcgccgcggccggccaa
gcagacccaggtgatgcccgcaccggcgtgggggcgagctcggctgcaccgaccggggta
ggcggcagcctggtggcctcgccgctaggcgaggtggtggtgtcagctggcacccagccg
caactgctggtcgccgacatcgatgtcgacaatgtggccgcggctcgcgaccgcattgcg
gtgctacgcaaccagacagacttcgttcagatcgataaggcacaatcgcgtgggtga

DBGET integrated database retrieval system