KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_08495Help
Entry
J113_08495        CDS       T02652                                 

Definition
(GenBank) putative glycosyl transferase
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
mtuc00500  Starch and sucrose metabolism
mtuc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    J113_08495
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtuc01003]
    J113_08495
Enzymes [BR:mtuc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     J113_08495
Glycosyltransferases [BR:mtuc01003]
 Polysaccharide
  Storage polysaccharide
   J113_08495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: AGL26699
UniProt: R4M4X7
Position
complement(1350590..1351753)
Genome map
AA seq 387 aa AA seqDB search
MRVAMLTREYPPEVYGGAGVHVTELVAYLRRLCAVDVHCMGAPRPGAFAYRPDPRLGSAN
AALSTLSADLVMANAASAATVVHSHTWYTALAGHLAAILYDIPHVLTAHSLEPLRPWKKE
QLGGGYQVSTWVEQTAVLAANAVIAVSSAMRNDMLRVYPSLDPNLVHVIRNGIDTETWYP
AGPARTGSVLAELGVDPNRPMAVFVGRITRQKGVVHLVTAAHRFRSDVQLVLCAGAADTP
EVADEVRVAVAELARNRTGVFWIQDRLTIGQLREILSAATVFVCPSVYEPLGIVNLEAMA
CATAVVASDVGGIPEVVADGITGSLVHYDADDATGYQARLAEAVNALVADPATAERYGHA
GRQRCIQEFSWAYIAEQTLDIYRKVCA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtggcgatgttgactcgggaatacccaccggaggtttacggtggagccggggta
catgtcaccgaactggttgcctacctacgccggctgtgcgcggtcgacgtgcactgcatg
ggcgcaccccgcccgggcgcatttgcctatcggcccgacccgaggctaggcagcgccaac
gcggcgctgtccaccttgtccgcggacctggtgatggccaatgccgccagcgcggccacc
gtcgtgcattcacacacctggtacaccgctctggcggggcatctggccgcgatactctac
gacatcccgcatgttttgaccgcacattcgctcgaaccgttgcggccatggaagaaggag
caactcggcggcggctaccaggtatcgacatgggtcgagcagaccgcggtgctggccgcc
aacgcggtcattgcggtcagttctgcaatgcgcaacgacatgttgcgggtctatcccagc
ctggatccgaacctggtgcacgtcatccggaacgggatcgacaccgagacgtggtatccg
gccgggcccgcgcgtaccgggtcggtgctggccgagctcggggtcgatccgaaccggccc
atggcggtgttcgtcgggcgaatcacccggcaaaagggagtcgtccacctggtaacagcc
gcgcaccgattcagatcggacgtacagctagtgctctgcgcgggtgctgcggacacgccg
gaagtagccgacgaagtgcgcgtcgcggtggccgaactggcccgcaatcgcactggcgtg
ttttggatccaagaccggcttaccatcggacaactacgagaaatactttcggcagcaaca
gttttcgtgtgcccgtcggtgtacgagccgctgggtatcgtaaacctggaagcgatggcg
tgcgcaaccgccgtggtggcctccgacgtcggcgggatccccgaggtggtcgccgacggg
atcaccggctcactggtgcattacgacgccgacgacgcgaccggttaccaggccagattg
gctgaggcggtcaatgccttggtcgccgacccggcaacggcggagcgctacgggcatgcc
ggacgccagcgctgtatccaagagttctcctgggcatacatcgccgagcagacactggac
atctaccggaaggtgtgcgcgtaa

DBGET integrated database retrieval system