KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_12945Help
Entry
J113_12945        CDS       T02652                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
mtuc00071  Fatty acid degradation
mtuc00072  Synthesis and degradation of ketone bodies
mtuc00280  Valine, leucine and isoleucine degradation
mtuc00310  Lysine degradation
mtuc00362  Benzoate degradation
mtuc00380  Tryptophan metabolism
mtuc00620  Pyruvate metabolism
mtuc00630  Glyoxylate and dicarboxylate metabolism
mtuc00640  Propanoate metabolism
mtuc00650  Butanoate metabolism
mtuc00900  Terpenoid backbone biosynthesis
mtuc01100  Metabolic pathways
mtuc01110  Biosynthesis of secondary metabolites
mtuc01120  Microbial metabolism in diverse environments
mtuc01130  Biosynthesis of antibiotics
mtuc01200  Carbon metabolism
mtuc01212  Fatty acid metabolism
mtuc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J113_12945
   00630 Glyoxylate and dicarboxylate metabolism
    J113_12945
   00640 Propanoate metabolism
    J113_12945
   00650 Butanoate metabolism
    J113_12945
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J113_12945
   00072 Synthesis and degradation of ketone bodies
    J113_12945
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J113_12945
   00310 Lysine degradation
    J113_12945
   00380 Tryptophan metabolism
    J113_12945
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J113_12945
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J113_12945
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J113_12945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtuc04147]
    J113_12945
Enzymes [BR:mtuc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J113_12945
Exosome [BR:mtuc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J113_12945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGL27314
UniProt: R4M6K9
Position
2110073..2111098
Genome map
AA seq 341 aa AA seqDB search
MAGAAELRIKLDRPAYVYPIFEQALRIAYGESIENHRKRIGELWARFSAVAADNPHAWIR
NPVTADEIWQPGPQNRMVSWPYTKLMNSNNMVDQGAALLLTSVERATRLRIPAERWVYPQ
AGTDAHDTPAVADRHRLHRSTAIRIAGARALELAGLGLDDIEYVDLYSCFPSAVQVAAAT
RPGHRDPARPLTVTGGLTFAGGPWSNYVTHSIATMAELLAANPGRRGLITANGGYLTKHS
FGVYGTEPPSEFRWEDMQPAVDREPTGDGLVEWEGIGTVEAWTTPVNRDGQPEKAFLAVR
TPDGSRSLAVITDPASVQATVREDIAGVKVAVAPDGTATLR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgcggctgagctgcggatcaagctggaccggccggcctacgtgtacccgata
ttcgagcaggcgctgcgcatcgcctacggcgagtcgatcgagaaccaccgaaagcggatc
ggcgagctgtgggcgcggttcagtgccgtagctgctgacaacccgcacgcgtggatccgc
aacccggttacggctgacgagatctggcagcccggcccacagaaccggatggtcagctgg
ccctacaccaagcttatgaactccaacaacatggttgaccagggtgccgcgctgctgctg
acgtcggtcgaacgtgcgacacgtctgcgaataccggccgaacgctgggtttatccacag
gctggcaccgacgcccacgacacaccggccgtcgccgaccgccaccgactgcatcggtcg
acggccattcggatcgccggtgcccgggcgctggaactggctgggctggggctcgatgac
atcgaatacgtcgacctgtattcgtgctttccctccgctgtccaggtcgccgcagcaact
cggcctggacaccgagatcctgcccgcccgctgaccgtcaccgggggcctgaccttcgcc
ggcgggccgtggagcaattacgtcacgcactccatcgccaccatggctgaactgctggcg
gccaatcccgggcgccgaggtctgatcaccgccaacggcggttacctgaccaaacacagt
ttcggggtctacggcaccgagccgccgtcggaattccgctgggaggacatgcaacccgcg
gtcgatagggagcccaccggagatgggttggtcgagtgggaaggcatcggcaccgtcgaa
gcgtggaccacaccagtcaaccgggacggacaacccgagaaggcgttcctggcggtgcgc
acgcccgacgggtcgcgcagcttggccgtgatcaccgatcccgcatcggtgcaagcaacg
gtgcgcgaggacatcgccggcgtcaaggttgccgtcgcccccgacggcaccgcgaccctg
cgatag

DBGET integrated database retrieval system