KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_15335Help
Entry
J113_15335        CDS       T02652                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system aminomethyltransferase T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
mtuc00260  Glycine, serine and threonine metabolism
mtuc00630  Glyoxylate and dicarboxylate metabolism
mtuc00670  One carbon pool by folate
mtuc01100  Metabolic pathways
mtuc01110  Biosynthesis of secondary metabolites
mtuc01130  Biosynthesis of antibiotics
mtuc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    J113_15335 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    J113_15335 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    J113_15335 (gcvT)
Enzymes [BR:mtuc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     J113_15335 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AGL27680
UniProt: R4MA01
Position
complement(2468839..2469978)
Genome map
AA seq 379 aa AA seqDB search
MCRQGRPLGWDAVSDVPELIHGPLEDRHRELGASFAEFGGWLMPVSYAGTVSEHNATRTA
VGLFDVSHLGKALVRGPGAAQFVNSALTNDLGRIGPGKAQYTLCCTESGGVIDDLIAYYV
SDDEIFLVPNAANTAAVVGALQAAAPGGLSITNLHRSYAVLAVQGPCSTDVLTALGLPTE
MDYMGYADASYSGVPVRVCRTGYTGEHGYELLPPWESAGVVFDALLAAVSAAGGEPAGLG
ARDTLRTEMGYPLHGHELSLDISPLQARCGWAVGWRKDAFFGRAALLAEKAAGPRRLLRG
LRMVGRGVLRPGLAVLVGDETVGVTTSGTFSPTLQVGIGLALIDSDAGIEDGQQINVDVR
GRAVECQVVCPPFVAVKTR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccggcagggacgcccattagggtgggacgccgtgagcgatgtgccagagctgata
cacggaccgctggaagaccgccatcgcgagctgggtgcgagtttcgccgagttcggcggc
tggctgatgccggtctcgtatgccggaaccgtcagcgagcacaacgccacccgcaccgcc
gtcggccttttcgacgtcagccacctgggcaaggcactggtccgtggaccgggtgcggcg
cagttcgtcaactccgcgctcaccaacgacctgggtcgtatcgggcccggcaaggcgcaa
tacaccttgtgctgcaccgaatccggcggtgtgatcgacgacctgatcgcctactacgtc
agcgacgacgagatctttctggtgcccaacgccgccaataccgccgcggtggtcggcgcg
ctacaagctgccgcaccgggcggtctgagcatcaccaatctgcatcggtcctacgcggtg
ctggccgtacaggggccgtgttcgaccgacgtgctcaccgcgttggggctgccaaccgag
atggactacatgggctacgccgacgcttcgtactcgggggtgccggtgcgtgtctgtcgc
accggctacaccggtgagcacggttacgaactgctgccgccatgggagtcggcgggtgtg
gtgttcgacgcactgttggcggcggtatcagccgcgggcggcgagcccgccggcctcggt
gctcgcgacacactgcgcactgaaatgggctatccgctgcacgggcacgagctttcgctg
gacatctcgccgctgcaggcccgatgcggctgggcggtcggctggcggaaggacgccttc
tttggtcgtgcggcgttgttggccgagaaagcggccgggccgcggcggctgctgcggggg
ctgcgcatggtcggtcgcggtgtgctgcgccccgggctggctgtgcttgtcggggatgag
acggttggggtcaccacgtcgggaacgttttctcccacgttgcaggtcggcatcgggctg
gcgctgatcgacagtgatgccggcatcgaagacggccagcaaatcaatgtcgacgtccgc
ggccgtgctgtcgaatgtcaagtggtgtgtccgccgttcgttgccgtgaaaacgcgctga

DBGET integrated database retrieval system