KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_16665Help
Entry
J113_16665        CDS       T02652                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
mtuc00430  Taurine and hypotaurine metabolism
mtuc00460  Cyanoamino acid metabolism
mtuc00480  Glutathione metabolism
mtuc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    J113_16665
   00460 Cyanoamino acid metabolism
    J113_16665
   00480 Glutathione metabolism
    J113_16665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mtuc01002]
    J113_16665
Enzymes [BR:mtuc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     J113_16665
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     J113_16665
Peptidases and inhibitors [BR:mtuc01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   J113_16665
CD molecules [BR:mtuc04090]
 Proteins
  J113_16665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AGL27847
UniProt: R4MK53
Position
2678783..2680714
Genome map
AA seq 643 aa AA seqDB search
MSVWLRAGALVAAVMLSLSGCGGFHAGAPSTAGPCEIVPNGTPAPKTPPATVPSSRNLAT
NPEIATGYRRDMTVVRTAHYAAATANPLATQVACRVLRDGGTAADAVVAAQAVLGLVEPQ
SSGDRGGGYLVYFDARTGSVQAYDGREVAPAAATENYLRWVSDVDRSAPRPNARASGRSI
GVPGILRMLEMVHNEHGRTPWRDLFGPAVTLADGGFDISARMGAAISDAASQLRDDPEAR
KYFLNPDGSPKPAGTRLTNPAYSKTLSAIASAGANAFYSGDIAHDIVAAASDTSNGRTPG
LLTIEDLAGYLAKRRQPLCTTYRGREICGMPSSGGVAVAATLGILEHFPMSDYAPSKVDL
NGGRPTVMGVHLIAEAERLAYADRDQYIADVDFVRLPGGSLTTLVDPGYLAARAALISPQ
HSMGSARPGDFGAPTAVAPPVPEHGTSHLSVVDSYGNAATLTTTVESSFGSYHLVDGFIL
NNQLSDFSAEPHATDGSPVANRVEPGKRPRSSMAPTLVFDHSSAGRGALYAVLGSPGGSM
IIQFVVKTLVAMLDWGLNPQQAVSLVDFGAANSPHTNLGGENPEINTSDDGDHDPLVQGL
RALGHRVNLAEQSSGLSAITRSEAGWAGGADPRREGAVMGDDA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtttggttgcgagcgggcgccttggtggctgcagtgatgctgtcgctgagcgga
tgtggcggcttccacgcgggtgcgccaagcacggccggtccgtgcgagatcgtccccaat
ggcacgccggcgcccaagacacccccggctaccgtgccttcgtcgcgcaacctcgcgacc
aaccccgagatcgccaccggctaccgccgggacatgaccgtggtgcggaccgcccactat
gcggcagccaccgccaatccgctggccactcaggtggcctgccgagtattgcgcgacggt
ggtaccgccgccgatgccgtcgtggccgcccaggcggtgctggggttggtcgaaccgcaa
tcctccggcgatcgcggcggcggatatctggtgtacttcgacgcccgcacgggctcagtg
caggcctacgacggccgtgaggtggccccagcggccgccaccgagaactaccttcgctgg
gtcagcgacgtcgaccgcagcgcgcccaggcccaacgcccgagcctcgggacggtcgatc
ggagtaccgggcatcctgcgaatgctggagatggtgcacaacgagcacgggcgcacaccc
tggcgcgacctcttcggccccgcggtaacgctggccgatggcggttttgacatcagcgcc
aggatgggcgcggccatctccgacgctgcgtcgcaactgcgagacgacccggaggctcgc
aagtatttcctcaatcccgacggcagcccgaaacccgcgggaacccggctgacgaacccc
gcgtactcaaaaaccctgtccgccatcgcctccgccggcgccaacgccttctattccggc
gacattgcccacgacatcgtggcggcggcgagcgacacatcgaatggccgcacgccgggc
ctgttgaccattgaggacctggcgggttacctcgccaagagacgccaaccgttgtgcacg
acctatcgcggccgggagatctgcggcatgccatcgtcgggtggcgtcgccgtggccgca
accttgggcatcctcgagcacttcccgatgagcgactacgcgcccagcaaggtcgacctc
aacggcggtcgcccgaccgtgatgggggttcacctgatagcggaggccgaacggctggcc
tatgccgaccgcgaccaatatatcgctgacgtcgattttgtccggctgcccggcggctcg
ctcaccacgctggttgacccgggctacttggcagcacgcgccgcgctaatctcgccgcaa
cacagcatgggcagcgccagaccgggggacttcggcgcaccgacggccgtcgccccgcca
gtgcctgagcatggcaccagccacctcagcgtcgtcgattcgtacggcaatgcggccacg
ttgacgacgacggtggaatcttcgttcggctcctaccacctggtggacggattcatcctc
aacaaccagctgagcgatttcagcgccgagccacacgctactgacggatcaccggtggct
aaccgggtcgagcctgggaagcgaccgcgcagttcgatggcaccgacgttggtgttcgat
cactcgtcggcggggcgcggtgcgctgtacgcggtgctcggttctccgggcggctccatg
atcatccagttcgtcgtgaaaacacttgtggcgatgctggattggggtctgaatccgcag
caggcggtttccctggtcgatttcggcgccgcgaactcgccgcacactaacctcggcggt
gagaatcccgagatcaacacttccgacgatggtgatcatgacccgctggtgcaaggcctg
cgcgcgctggggcatcgagttaatcttgccgagcaatccagtgggctctcggcgatcacc
cgcagcgaggcgggttgggccggcggcgccgacccacgccgcgaaggcgcggtcatgggc
gacgatgcctga

DBGET integrated database retrieval system