KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_24715Help
Entry
J113_24715        CDS       T02652                                 

Definition
(GenBank) 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
mtuc00360  Phenylalanine metabolism
mtuc00362  Benzoate degradation
mtuc00621  Dioxin degradation
mtuc00622  Xylene degradation
mtuc01100  Metabolic pathways
mtuc01120  Microbial metabolism in diverse environments
mtuc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    J113_24715
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J113_24715
   00622 Xylene degradation
    J113_24715
   00621 Dioxin degradation
    J113_24715
Enzymes [BR:mtuc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     J113_24715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AGL29009
UniProt: R4MBD8
Position
complement(3955191..3955505)
Genome map
AA seq 104 aa AA seqDB search
MFDKIGVKTGIDFFDIADAAEDVVRPAMPAECLLDRNALIMGYSGVYSSFLKHAVRQAER
YGVPASALLHRAGQRKLIGGQEDQLIDIALEIKRELDSGAAVTH
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgacaagatcggcgtcaagaccggcattgatttcttcgacattgccgacgccgcc
gaggacgtggtgcgcccggccatgccggccgaatgtctgctcgaccgcaacgcgttgatc
atggggtattccggggtctactccagcttcctcaagcatgcggtccgccaggccgagcgc
tacggcgtgccggcgtcggcgctgttgcaccgggccggtcagcgcaagctcatcggtggc
caggaagaccagctcatcgacatcgcgctggaaatcaaacgcgagctggatagcggtgcg
gccgtaacgcattga

DBGET integrated database retrieval system