KEGG   Mycobacterium tuberculosis EAI5/NITR206: J114_03370Help
Entry
J114_03370        CDS       T02653                                 

Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
mtue  Mycobacterium tuberculosis EAI5/NITR206
Pathway
mtue03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtue00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J114_03370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mtue03400]
    J114_03370
Enzymes [BR:mtue01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     J114_03370
DNA repair and recombination proteins [BR:mtue03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J114_03370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AGL30067
Position
complement(724892..728185)
Genome map
AA seq 1097 aa AA seqDB search
MALHLHRAERTDLLADGLGALLADPQPDPFAQELVLVAARGVERWLSQRLSLVLGCGPGR
ADGVCAGIAFRNPQSLIAEITGTLDDDPWSPEALAWPLLAVIDASLDEPWCRTLASHLGH
FATTDAEAELRRGRRYSVARRLAGLFASYARQRPGLLAAWLDGDLGELPGDLAWQPPLWR
ALVTTVGADPPHVRHDKTIARLRDGPADLPARLSLFGHTRLACTDVQLLDALAVHHDLHL
WLPHPSDELWRALAGFQGADGLLPRRQDTSRRAAQHPLLETLGRDVRELQRALPAARATD
EFLGATTKPDTLLGWLQADIAGNAPRPAGRSLSDADRSVQVHACHGPARQIDVLREVLLG
LLEDDPTLQPRDIVVMCPDIDTYAPLIVAGFGLGEVAGDCHPAHRLRVRLADRALTQTNP
LLSVAAELLTIAETRATASQLLNLAQAAPVRAKFGFADDDLDTITTWVRESNIRWGFDPT
HRRRYGLDTVVHNTWRFGLDRILTGVAMSEDSQAWLDTALPLDDVGSNRVELAGRLAEFV
ERLHHVVGGLSGARPLVAWLDALATGIDLLTACNDGWQRAQVQREFADVLARAGSRAAPL
LRLPDVRALLDAQLAGRPTRANFRTGTLTVCTMVPMRSVPHRVVCLVGLDDGVFPRLSHP
DGDDVLAREPMTGERDIRSEDRQLLLDAIGAATQTLVITYTGADERTGQPRPPAVPLAEL
LDALDQTTSAPVRERILVTHPLQPFDRKNVTPGALLGAKPFTFDPAALAAAQAAAGKRCP
PTAFISGRLPAPPAADVTLADLLDFFKDPVKGFFRALDYTLPWDVDTVEDSIPVQVDALA
EWTVGERMLRDMLRGLHPDDAAHSEWRRGTLPPGRLGVRRAKEIRNRARDLAAAALAHRD
GHGQAHDVDVDLGDGRRLSGTVTPVFGGRTVSVTYSKLAPKHVLPAWIGLVTLAAQEPGR
EWSALCIGRSKTRNHIARRLFVPPPDPVAVLRELVLLYDAGRREPLPLPLKTSCAWAQAR
RDGQDPYPPARECWQTNRFRPGDDDAPAHVRAWGPRAPFEVLLGKPRAGEEVAGEETRLG
ALAARLWLPLLAAEGSV
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcacctgcaccgtgccgagcgcaccgatctgcttgccgacgggctcggcgcg
ctgctggccgatccccagcccgaccctttcgcgcaggaactggtgctggtcgctgcccgc
ggcgtggaacgctggctgagccaacggctttcgctcgtgttgggctgcgggccgggccgc
gccgacggggtgtgcgccggcatcgcgttccgcaatccgcagtccctgatcgccgagatc
accggcaccctcgacgacgacccgtggtcgccggaagccctggcgtggccgctgctggcg
gtgatcgacgccagcctcgacgaaccgtggtgccgcacgctggcatcccacttggggcac
ttcgcgacgaccgatgccgaggcggagctgcgccgcggccggcgctattcggtggcgcgc
cggctagccgggctgttcgcgtcctatgcacgccagcgtcccgggttgctggccgcttgg
ctggacggcgacctcggcgagctgcccggcgacttggcctggcaaccgccactgtggcgc
gccctggtgaccacggtcggggccgatcccccgcatgtccgccacgacaagaccatcgcc
cggctgcgcgacggccccgccgacctgccggctcggctttcgctgttcggccacacccgc
ctggcctgcaccgacgtgcagctgctggatgcgctggccgtccaccacgacctgcacctg
tggctgccgcaccccagcgacgagttgtggcgggcgctggccggcttccagggcgctgat
ggcctgctgccgcggcggcaggacaccagccggcgggccgcccagcacccgctgctggaa
acgctgggccgcgacgtgcgcgaactgcagcgcgcgctgcccgccgcccgggccaccgac
gaattccttggtgccacaaccaaacccgacacgttgctgggatggctgcaagccgacatc
gccggcaacgcgccgcgacccgccgggcgtagcttgtcggatgccgaccgatcggtgcag
gtccatgcctgtcacggcccggcgcggcaaatcgatgtgctgcgcgaggtgctgctcggc
ctcctcgaggacgacccgacgctgcaaccgcgcgacatcgtggtgatgtgccccgacatc
gacacctacgcaccgttgatcgtcgccggcttcggcctcggtgaggtggccggcgactgc
caccccgcacaccggctgcgggtgcgtctggccgaccgcgccctgacccagaccaatccg
ctgctctcggtggccgccgaactgctcaccatcgccgaaacccgggccaccgccagccaa
ctgctcaacctcgcgcaggccgctccggtgcgcgccaaattcgggttcgccgacgacgac
ctggacaccatcaccacgtgggtgcgcgaatcgaacatccgctggggcttcgacccgacg
caccggcgacgctatggcctcgacaccgtcgtgcacaacacgtggcggttcggactcgac
cgcatcctcaccggggtggccatgtccgaggattcccaagcgtggctggataccgcgctg
ccccttgatgacgtcggcagcaatcgggtcgagctggccgggaggctggccgagttcgtc
gaacggttgcatcatgtcgtcggcggactcagcggtgcacggccgttggtcgcatggctg
gatgcgctggccacggggatcgatctgctgaccgcctgtaacgacggctggcaacgcgcg
caggtgcagcgggagttcgccgacgtgctggcgcgcgccggttcgcgcgcggcgccgctg
ttgcggctgcccgacgtgcgagcgcttttggacgcgcagctggccgggcgcccgacccgg
gccaactttcgcaccggcacgctgaccgtctgcacgatggtcccgatgcgctcggtgccg
caccgggtggtgtgcctggtgggtctggacgacggcgtgtttccgcggctgagccatccc
gacggggacgacgtgctggcccgagaaccgatgacgggtgaacgtgacatccgttcggag
gaccggcaattgctgctggacgcgataggtgcggccacccagaccctggtgatcacttac
accggcgccgacgagcgcaccgggcaaccgcgcccacccgcggtgccgctggccgagttg
ctcgacgcgctcgaccagacgacgtcagcgccggtgcgtgagcggatcctggtcacacac
ccactgcagccgttcgaccggaagaacgtcacccccggcgcactgctgggcgccaagccg
ttcacgttcgaccccgccgcgctcgccgccgcccaggccgccgccgggaagcgctgtcca
ccaacggctttcatctccggtcggctgcccgcaccacccgcggccgacgtgacgctggcg
gacctgctcgacttcttcaaggatccggtcaaggggttcttccgggcgctggactacacg
ctgccctgggacgtcgacaccgtcgaggactcgataccggtccaggtcgacgccttggcc
gagtggacggtgggcgagcggatgttgcgcgacatgctccgcggcctgcaccccgacgac
gccgctcactccgaatggcgtcgcggcacgttgccgcccgggcgcctcggcgtgcgacgg
gcgaaggaaatccggaaccgcgcgcgcgatctggcggccgccgcgctggcgcaccgcgac
ggccacggccaggcgcacgacgtcgacgtcgacctcggcgacgggcggcgactgagcggc
acggtgacacccgtgttcggcgggcgcacggtgtcggtgacctactcaaagctggcgccc
aagcatgtgttgccggcgtggatcggcctggttacgctggccgcccaagagcctggccgc
gagtggtcggcgctgtgcatcggccgcagcaagaccaggaaccacatcgccagaaggctt
ttcgtgccgccgccggacccggtggcggtattgcgggagctggtgttgctgtacgacgcc
ggccggcgcgaaccactgccgctgccgctgaagacgtcctgcgcgtgggcccaggcacgc
cgagacggccaagacccctacccgcccgcccgcgaatgctggcagaccaacaggttccgg
ccgggcgacgacgacgcgcccgcccacgtgcgagcctggggcccgcgcgcacccttcgag
gtgttgctcggcaagccccgcgcgggcgaagaggtcgccggggaagagacccggctaggg
gcgctggccgcccggctatggctgccgctgttggccgccgaagggtcggtctga

DBGET integrated database retrieval system