KEGG   Mycobacterium tuberculosis EAI5/NITR206: J114_09950Help
Entry
J114_09950        CDS       T02653                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtue  Mycobacterium tuberculosis EAI5/NITR206
Pathway
mtue00071  Fatty acid degradation
mtue00072  Synthesis and degradation of ketone bodies
mtue00280  Valine, leucine and isoleucine degradation
mtue00310  Lysine degradation
mtue00362  Benzoate degradation
mtue00380  Tryptophan metabolism
mtue00620  Pyruvate metabolism
mtue00630  Glyoxylate and dicarboxylate metabolism
mtue00640  Propanoate metabolism
mtue00650  Butanoate metabolism
mtue00900  Terpenoid backbone biosynthesis
mtue01100  Metabolic pathways
mtue01110  Biosynthesis of secondary metabolites
mtue01120  Microbial metabolism in diverse environments
mtue01130  Biosynthesis of antibiotics
mtue01200  Carbon metabolism
mtue01212  Fatty acid metabolism
mtue02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J114_09950
   00630 Glyoxylate and dicarboxylate metabolism
    J114_09950
   00640 Propanoate metabolism
    J114_09950
   00650 Butanoate metabolism
    J114_09950
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J114_09950
   00072 Synthesis and degradation of ketone bodies
    J114_09950
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J114_09950
   00310 Lysine degradation
    J114_09950
   00380 Tryptophan metabolism
    J114_09950
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J114_09950
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J114_09950
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J114_09950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtue04147]
    J114_09950
Enzymes [BR:mtue01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J114_09950
Exosome [BR:mtue04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J114_09950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AGL31337
Position
2109985..2111469
Genome map
AA seq 494 aa AA seqDB search
MPVDPRTPVLIGYGQVNHRGDIDAEKQSIEPVDLMAAAARKAADSTVLEAVDSIRVVHML
SAHYRNPGQLLGERIKARTFTTGYSGVGGNMPQSLVNRACLDIQRGRAGVVLLAGAETWR
TRTGLRAKGSKLEWTVQDESVPLPDMAGDDVPMAGAAELRINLDRPAYVYPIFEQALRIA
YGESIENHRKRIGELWARFSAVAADNPHAWIRNPVTADEIWQPGPQNRMVSWPYTKLMNS
NNMVDQGAALLLTSVERATRLRIPAERWVYPQAGTDAHDTPAVADRHRLHRSTAIRIAGA
RALELAGLGLDDIEYVDLYSCFPSAVQVAAIELGLDTDDPARPLTVTGGLTFAGGPWSNY
VTHSIATMAELLAANPGRRGLITANGGYLTKHSFGVYGTEPPSEFRWEDMQPAVDREPTG
DGLVEWEGIGTVEAWTTPVNRDGQPEKAFLAVRTPDGSRSLAVITDPASVQATVREDIAG
VKVAVAPDGTATLR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccggtagaccccaggacgccagtgctgatcggctatggacaggtcaaccaccgaggc
gacatcgacgccgagaagcagtccatcgaacccgtcgacctgatggccgccgcggcccgg
aaagccgcggattcgacggtgctcgaggcggtggattcgatccgtgtggtgcacatgctg
tcggcgcattaccggaatcccgggcagctcctcggcgaacgaatcaaggcgaggaccttc
accaccggttacagcggggtgggcggcaacatgccgcaatccctggtcaaccgggcatgc
ctggacatccagcgcgggcgggccggcgtggtgctgctggctggcgccgaaacctggcgc
acccgaacgggcctgcgcgccaagggcagcaaactggagtggactgtgcaggacgaatcc
gttccgctgccggacatggccggcgacgacgttccgatggccggtgcggctgagctgcgg
atcaacctggaccggccggcctacgtgtacccgatattcgagcaggcgctgcgcatcgcc
tacggcgagtcgatcgagaaccaccgaaagcggatcggcgagctgtgggcgcggttcagt
gccgtagctgctgacaacccgcacgcgtggatccgcaacccggttacggctgacgagatc
tggcagcccggcccacagaaccggatggtcagctggccctacaccaagcttatgaactcc
aacaacatggttgaccagggtgccgcgctgctgctgacgtcggtcgaacgtgcgacacgt
ctgcgaataccggccgaacgctgggtttatccacaggctggcaccgacgcccacgacaca
ccggccgtcgccgaccgccaccgactgcatcggtcgacggccattcggatcgccggtgcc
cgggcgctggaactggctgggctggggctcgatgacatcgaatacgtcgacctgtattcg
tgctttccctccgctgtccaagtcgccgcaatcgaactcggcctggacaccgacgatcct
gcccgcccgctgaccgtcaccgggggcctgaccttcgccggcgggccgtggagcaattac
gtcacgcactccatcgccaccatggctgaactgctggcggccaatcccgggcgccgaggt
ctgatcaccgccaacggcggttacctgaccaaacacagtttcggggtctacggcaccgag
ccgccgtcggaattccgctgggaggacatgcaacccgcggtcgatagggagcccaccgga
gatgggttggtcgagtgggaaggcatcggcaccgtcgaagcgtggaccacaccagtcaac
cgggacggacaacccgagaaggcgttcctggcggtgcgcacgcccgacgggtcgcgcagc
ttggccgtgatcaccgatcccgcatcggtgcaagcaacggtgcgcgaggacatcgccggc
gtcaaggttgccgtcgcccccgacggcaccgcgaccctgcgatag

DBGET integrated database retrieval system