KEGG   Mycobacterium tuberculosis EAI5/NITR206: J114_18570Help
Entry
J114_18570        CDS       T02653                                 

Definition
(GenBank) 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mtue  Mycobacterium tuberculosis EAI5/NITR206
Pathway
mtue00360  Phenylalanine metabolism
mtue00362  Benzoate degradation
mtue00621  Dioxin degradation
mtue00622  Xylene degradation
mtue01100  Metabolic pathways
mtue01120  Microbial metabolism in diverse environments
mtue01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtue00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    J114_18570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J114_18570
   00622 Xylene degradation
    J114_18570
   00621 Dioxin degradation
    J114_18570
Enzymes [BR:mtue01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     J114_18570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like ComA LETM1
Motif
Other DBs
NCBI-ProteinID: AGL32979
Position
complement(3866319..3867329)
Genome map
AA seq 336 aa AA seqDB search
MLMTATHREPIVLDTTVRDGSYAVNFQYTDDDVRRIVGDLDAAGIPYIEIGHGVTIGAAA
AQGPAAHTDEEYFRAARSVVRNARLGAVIVPALARIETVDLAGDYLDFLRICVIATEFEL
VMPFVERAQSKGLEVSIQLVKSHLFEPDVLAAAGKRARDVGVRIVYVVDTTGTFLPEDAR
RYVEALRGASDVSVGFHGHNNLAMAVANTLEAFDAGADFLDGTLMGFGRGAGNCQIECLV
AALQRRGHLAAVDLDRIFDAARSDMLGRSPQSYGIDPWEISFGFHGLDSLQVEHLRAAAQ
QAGLSVSHVIRQTAKSHAGQWLSPQDIDRVVVGMRA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgactgcgacccacagagagccgattgtcctggacacgaccgtccgtgacggc
agctatgcggtgaacttccagtacaccgacgacgatgtccgcaggattgtcggggatctc
gacgcagcgggaattccctacattgaaatcggtcacggcgtcaccatcggagccgccgcg
gcgcagggcccggcggctcacaccgacgaagaatatttccgcgccgcccgatcggtggtt
cgaaacgcgagacttggtgccgtgatcgtgccggccctggcccgcatcgagacggtcgat
ttggccggagactatctggactttctgcgcatatgtgtcatcgccaccgaatttgagttg
gtgatgccgttcgtcgagcgtgcgcagtcaaaaggtctggaggtttcgatccagctggtg
aagtcgcatctcttcgagcccgatgtgcttgctgctgccgggaagcgggcccgcgatgtg
ggcgtccggatcgtttacgtggtggatacgacgggaaccttcctgcccgaggacgcgcgc
cgctacgtcgaggctctccgcggtgccagcgatgtctccgtcggcttccacgggcacaac
aacctcgccatggccgtcgccaacaccttggaggcattcgacgccggggccgatttcctg
gatggaacgctgatgggtttcggtcgcggggccgggaattgccagatcgagtgcctcgtc
gccgcgttgcagcggcgcgggcacctggcggcagtcgacctggatcggattttcgacgca
gcgcgatcggatatgttgggccggagcccgcagagttacggcatcgatccgtgggagatc
tcgttcggattccacggactcgattcgctgcaggtcgagcacctccgcgcagcggcccaa
caggcggggctttccgtgtcccacgttattcggcagaccgcgaaaagtcatgcggggcag
tggttgtccccgcaagacatcgatcgagtggtcgtgggaatgagggcgtga

DBGET integrated database retrieval system