KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_06045Help
Entry
I917_06045        CDS       T02654                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh00071  Fatty acid degradation
mtuh00072  Synthesis and degradation of ketone bodies
mtuh00280  Valine, leucine and isoleucine degradation
mtuh00310  Lysine degradation
mtuh00362  Benzoate degradation
mtuh00380  Tryptophan metabolism
mtuh00620  Pyruvate metabolism
mtuh00630  Glyoxylate and dicarboxylate metabolism
mtuh00640  Propanoate metabolism
mtuh00650  Butanoate metabolism
mtuh00900  Terpenoid backbone biosynthesis
mtuh01100  Metabolic pathways
mtuh01110  Biosynthesis of secondary metabolites
mtuh01120  Microbial metabolism in diverse environments
mtuh01130  Biosynthesis of antibiotics
mtuh01200  Carbon metabolism
mtuh01212  Fatty acid metabolism
mtuh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I917_06045
   00630 Glyoxylate and dicarboxylate metabolism
    I917_06045
   00640 Propanoate metabolism
    I917_06045
   00650 Butanoate metabolism
    I917_06045
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I917_06045
   00072 Synthesis and degradation of ketone bodies
    I917_06045
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I917_06045
   00310 Lysine degradation
    I917_06045
   00380 Tryptophan metabolism
    I917_06045
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I917_06045
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I917_06045
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I917_06045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtuh04147]
    I917_06045
Enzymes [BR:mtuh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I917_06045
Exosome [BR:mtuh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I917_06045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGL22589
UniProt: R4LT69
Structure
PDB: 

Position
957180..958391
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQKNGSXHXVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVS
PVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMGLDPATNYDVMFVPQSIGADLIATIEGFSREDVDAYALRSQQKAAE
AWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQ
KYHWVEKINHVHTGGNSSGIVDGAALVMIXXAAAGKLQGLTPRARIVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagccttcatctacgaggccatccgcaccccgcgcggcaaacaaaagaac
ggatcgttscacraagtmaagccattgagcctggtcgtcggcctgatcgacgagctgcgc
aagcgccatcccgacctcgacgagaacctgatcagcgacgtcatcttgggctgcgtctca
ccggtgggcgaccagggcggcgacatcgcccgcgccgcagtgctggcatcgggcatgccg
gtcacctccggcggtgtgcagctcaaccggttctgcgcgtccggcctggaggccgtcaac
accgccgcgcagaaggtgcgttcgggctgggatgacctggtgctggccggcggcgtggag
tcgatgagccgggtgccgatgggctccgacggcggcgctatgggcctggacccggcgacc
aactacgacgtcatgttcgtcccgcagagcatcggcgccgacctgatcgccaccatcgag
ggcttctcccgcgaagacgtcgacgcctacgcgctacgcagccagcaaaaggccgccgag
gcgtggtcgggcggctacttcgccaagtcggtggtgccggtgcgcgaccagaacggcctg
ctgatcctcgatcatgacgaacacatgcggccggacaccaccaaggagggtctggccaag
ctgaagccggccttcgaaggcctggccgcgctgggcggtttcgacgacgtggcgctgcag
aagtaccactgggtggaaaagatcaaccacgtacacaccggcggcaacagctcggggatc
gtcgacggtgccgcgctggtgatgatcgktyccgcggccgccggcaagttgcagggcctg
actccgcgggcgcgcatcgtcgccaccgccaccagcggcgccgacccggtgatcatgctc
accggccccaccccggccacccgcaaggtgctcgaccgcgccgggctgaccgtcgacgac
atcgacctgttcgagctcaacgaggcgttcgcgtcggtggtgctgaagttccagaaggac
ctcaacattcccgacgagaagctcaacgtcaacggtggcgccatcgcgatgggccacccg
ctgggtgccaccggcgcgatgatcctgggcaccatggtcgacgaactggagcgccgcaac
gcccgacgtgcactcatcacgctgtgcatcgggggcggcatgggtgtcgcgacgatcatc
gagagggtttaa

DBGET integrated database retrieval system