KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_23275Help
Entry
I917_23275        CDS       T02654                                 

Definition
(GenBank) acid phosphatase
  KO
K21302  phosphatidylinositol-3-phosphatase [EC:3.1.3.64]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh00562  Inositol phosphate metabolism
mtuh01100  Metabolic pathways
mtuh05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    I917_23275
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    I917_23275
Enzymes [BR:mtuh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     I917_23275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AGL24871
UniProt: R4MAE3
Position
3691693..3692592
Genome map
AA seq 299 aa AA seqDB search
MLRGIQALSRPLTRVYRALAVIGVLAASLLASWVGAVPQVGLAASALPTFAHVVIVVEEN
RSQAAIIGNKSAPFINSLAANGAMMAQAFAETHPSEPNYLALFAGNTFGLTKNTCPVNGG
AXPXLGSELLSAGYTFMGFAEDLPAVGSTVCSAGKYARKHVPWVNFSNVPTTLSVPFSAF
PKPQNYPGLPTVSFVIPNADNDMHDGSIAQGDAWLNRHLSAYANWAKTNNSLLVVTXDED
DGXSRNQIPTVFYGAHVRPGTYNETISHYNVLSTLEQIYGLPKTGYATNAPPITDIWGD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcggaatccaggctctcagccggcccctgaccagggtataccgtgccttggcg
gtgatcggtgtcctggcagcatcgttgctggcctcatgggtcggcgctgtcccacaagtg
ggtctggcagcgagtgccctgccgaccttcgcgcacgtggtcatcgtggtggaggagaac
cgctcgcaggccgccatcatcggtaacaagtcggctcccttcatcaattcgctggccgcc
aacggcgcgatgatggcccaggcgttcgccgaaacacacccgagcgaaccgaactacctg
gcactgttcgctggcaacacattcgggttgacgaagaacacctgccccgtcaacggcggs
gcgckgcccmacctgggttctgagttgctcagcgccggttacacattcatggggttcgcc
gaagacttgcctgcggtcggctccacggtgtgcagtgcgggcaaatacgcacgcaaacac
gtgccgtgggtcaacttcagtaacgtgccgacgacactgtcggtgccgttttcggcattt
ccgaagccgcagaattaccccggcctgccgacggtgtcgtttgtcatccctaacgccgac
aacgacatgcacgacggctcgatcgcccaaggcgacgcctggctgaaccgccacctgtcg
gcatatgccaactgggccaagacaaacaacagcctgctcgttgtgacckgggacgaagac
gacggcascagccgcaatcagatcccgacggtgttctacggcgcgcacgtgcggcccgga
acttacaacgagaccatcagccactacaacgtgctgtccacattggagcagatctacgga
ctgcccaagacgggttatgcgaccaatgctccgccaataaccgatatttggggcgactag

DBGET integrated database retrieval system