KEGG   Mycobacterium tuberculosis Haarlem: TBHG_00147Help
Entry
TBHG_00147        CDS       T02845                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD+)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00010  Glycolysis / Gluconeogenesis
mtul00053  Ascorbate and aldarate metabolism
mtul00071  Fatty acid degradation
mtul00280  Valine, leucine and isoleucine degradation
mtul00310  Lysine degradation
mtul00330  Arginine and proline metabolism
mtul00340  Histidine metabolism
mtul00380  Tryptophan metabolism
mtul00410  beta-Alanine metabolism
mtul00561  Glycerolipid metabolism
mtul00620  Pyruvate metabolism
mtul00625  Chloroalkane and chloroalkene degradation
mtul00903  Limonene and pinene degradation
mtul01100  Metabolic pathways
mtul01110  Biosynthesis of secondary metabolites
mtul01120  Microbial metabolism in diverse environments
mtul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBHG_00147
   00053 Ascorbate and aldarate metabolism
    TBHG_00147
   00620 Pyruvate metabolism
    TBHG_00147
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TBHG_00147
   00561 Glycerolipid metabolism
    TBHG_00147
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBHG_00147
   00310 Lysine degradation
    TBHG_00147
   00330 Arginine and proline metabolism
    TBHG_00147
   00340 Histidine metabolism
    TBHG_00147
   00380 Tryptophan metabolism
    TBHG_00147
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBHG_00147
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TBHG_00147
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TBHG_00147
Enzymes [BR:mtul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     TBHG_00147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: EBA44156
Position
173556..175076
Genome map
AA seq 506 aa AA seqDB search
MSDRVKAVAPPDGRTMMTTESVARKTQKSETEAPREPAPVSDEKQTDVAKTVARLRKTFA
SGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAYLADIATTSAEAKYAAK
RVRRWMRRRYLLLEVPQLPGRGWVEYEPYGTVLIIGAWNYPFYLTLGPAVGAIAAGNAVV
LKPSEIAAASAHLMTELVYRYLDTEAIAVVQGDGAVSQELIAQGFDRVMFTGGTEIGRKV
YEGAAPHLTPVTLELGGKSPVIVAADADVDVAAKRIAWIKLLNAGQTCVAPDYVLADATV
RDELVSKITAALTKFRSGAPQGMRIVNQRQFDRLSGYLAAAKTDAAADGGGVVVGGDCDA
SNLRIQPTVVVDPDPDGPLMSNEIFGPILPVVTVKSLDDAIRFVNSRPKPLSAYLFTKSR
AVRERVIREVPAGGMMVNHLAFQVSTAKLPFGGVGASGMGAYHGRWGFEEFSHRKSVLTK
PTRPDLSSFIYPPYTERAIKVARRLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgcgtcaaggcggtcgcgccgccggacggaaggacgatgatgaccaccgaa
tcggttgcccggaagacccagaaatctgagaccgaggctccgcgcgaaccggcgcccgtt
tcggatgaaaagcaaaccgatgtcgctaaaacggtggctcggctgcgaaagacctttgcc
agcgggcgtacccgcagcgtcgagtggcgcaagcagcagttgcgcgcgctacagaagttg
atggacgagaacgaggacgcgatcgccgcggcactcgccgaggatctggatcgcaatccg
ttcgaggcatacctcgctgacatcgcgacgacctccgccgaagcgaaatacgcggccaag
cgggtgcgcaggtggatgcggcgccgctacctgctgctcgaggtgccgcagctgcccggc
cgcggctgggtggagtacgagccatatggcaccgtgctaatcatcggtgcctggaactac
ccgttctacctgaccctgggtccggcggtcggagccattgccgctggaaacgccgtcgtg
ctcaaaccgtcggaaatcgccgctgcatcggcgcacttgatgaccgaattggtgtatcgc
tatctcgacaccgaagcgatcgcggtcgtgcagggcgatggtgcggtgagtcaggagctg
atcgctcagggtttcgaccgcgtgatgttcaccggtggcaccgagatcggccgcaaggtc
tacgaaggcgccgcgccgcacctgaccccggtcaccctcgagctcggcggcaagagcccg
gtgatcgtcgcggccgatgccgatgtagatgtcgcggccaagcggatcgcctggatcaaa
ctgctcaacgccgggcagacatgcgttgcacccgactatgtgctggcggatgccaccgtc
cgcgacgagctggtcagcaagatcaccgcggccctcaccaagttccgctccggtgcgccg
cagggcatgcgcatcgtcaaccagcgtcaattcgaccggctgagtggatacctcgccgca
gcgaaaaccgacgctgcagccgacggcggcggggtcgtcgtgggcggcgactgtgacgca
tcgaacctgcgcatccaacccaccgtggtcgtcgatcccgacccggacgggccgttgatg
agcaacgagatcttcggaccgatcctgccggtggtcaccgtcaaatctctggacgacgcg
attcgcttcgtgaactcgcggcccaagccgctatcggcgtacctgttcactaagtcgcgt
gcggttcgcgagcgggtgatcagggaggtgccggcgggcggaatgatggttaaccatttg
gcttttcaggtgtcgacggccaaactgccgttcggtggtgtcggcgcatcgggcatgggt
gcctaccacggccgttggggtttcgaggagttcagccaccgtaagtcggtgttgaccaaa
ccaacccgacccgacctgtccagctttatctacccgccgtacaccgagcgcgccatcaag
gtggctcgccggctgttctga

DBGET integrated database retrieval system