KEGG   Mycobacterium tuberculosis Haarlem: TBHG_00243Help
Entry
TBHG_00243        CDS       T02845                                 

Definition
(GenBank) acetyl-CoA acyltransferase FadA2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00071  Fatty acid degradation
mtul00072  Synthesis and degradation of ketone bodies
mtul00280  Valine, leucine and isoleucine degradation
mtul00310  Lysine degradation
mtul00362  Benzoate degradation
mtul00380  Tryptophan metabolism
mtul00620  Pyruvate metabolism
mtul00630  Glyoxylate and dicarboxylate metabolism
mtul00640  Propanoate metabolism
mtul00650  Butanoate metabolism
mtul00900  Terpenoid backbone biosynthesis
mtul01100  Metabolic pathways
mtul01110  Biosynthesis of secondary metabolites
mtul01120  Microbial metabolism in diverse environments
mtul01130  Biosynthesis of antibiotics
mtul01200  Carbon metabolism
mtul01212  Fatty acid metabolism
mtul02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBHG_00243
   00630 Glyoxylate and dicarboxylate metabolism
    TBHG_00243
   00640 Propanoate metabolism
    TBHG_00243
   00650 Butanoate metabolism
    TBHG_00243
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TBHG_00243
   00072 Synthesis and degradation of ketone bodies
    TBHG_00243
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBHG_00243
   00310 Lysine degradation
    TBHG_00243
   00380 Tryptophan metabolism
    TBHG_00243
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TBHG_00243
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBHG_00243
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TBHG_00243
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtul04147]
    TBHG_00243
Enzymes [BR:mtul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TBHG_00243
Exosome [BR:mtul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBHG_00243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: EBA44246
Position
292491..293813
Genome map
AA seq 440 aa AA seqDB search
MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAALSGLVDRFGLAGERLD
MVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQAAIAAADGIAAGRYEV
AAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTLPASLGVEIPANSEPRTG
LSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFDDLVSPFLGLYRDDNLRPN
SSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLASEQWAEAHSLAPLAYLVDAE
TAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEIHEAFASVVLAHLAAWESEEY
CKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRILAQTAKQLAEKKAAKKGGGPL
RGLISICAAGGQGVAAILEA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggcccctgctgctaagaacacttcacagaccaggcggcgagtcgccgtactgggcggc
aaccgcatcccgttcgccagatcggacggtgcctacgcggatgcgtccaaccaggacatg
ttcaccgcggcgctgagcggcttggtggaccgattcggactcgccggcgagcggctggac
atggtggtgggcggtgcggtgctcaaacacagccgcgacttcaatctaatgcgcgaatgc
gtgctgggctccgaactctcgccgtacacgccggcgttcgacctgcagcaggcctgcggg
acgggcctgcaggccgcgatcgcggccgccgacggcattgccgccgggcggtatgaggtg
gccgccgctggcggggtggacaccacctcggacccgccgatcggcctgggcgacgacctg
cgccgcaccctgctcaagctgcgccgatctaggtccaacgtgcaacgcctcaagctggtg
ggcacgctgccggccagcctgggcgtggagatccccgccaacagcgagccgcgcaccggg
ctgtcgatgggcgagcacgccgccgtcaccgccaagcagatgggcatcaaacgcgtagac
caggacgagctggccgccgccagccatcgcaatatggccgacgcctacgaccggggtttc
ttcgacgacctggtcagtccgtttttagggctgtaccgagacgacaatctgcggcctaac
tccagcgtcgagaaactggccacgctgcgtccggtcttcggagtgaaggccggtgacgcg
acgatgacggccggcaattcgactccgctgaccgacggcgcctcggtggcattgctggcc
agcgaacagtgggcggaggcacactcgctggctccgctggcctatctcgtggatgccgag
accgccgcggtcgactatgtcaacggcaacgacggcctgttgatggcgccgacctacgcg
gtaccccggctgctggcccgtaacgggttgagcctgcaggacttcgacttctacgaaatc
cacgaggcgtttgcctccgtggtgctcgcgcatctggcggcgtgggagtccgaggagtac
tgcaagcggcggctgggcctggacgccgcgctggggtcgatcgatcggtccaagctcaac
gtcaacgggtcgtcgttggccgccgggcaccccttcgcggcgaccggtgggcggattttg
gcgcagaccgccaagcagctcgccgagaagaaggcggcgaaaaaaggcggcggaccgctg
cgcgggctgatttcgatctgcgcggccggcggccaaggtgtggccgcgattttggaggcc
tga

DBGET integrated database retrieval system