KEGG   Mycobacterium tuberculosis Haarlem: TBHG_00523Help
Entry
TBHG_00523        CDS       T02845                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase HemL
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00860  Porphyrin and chlorophyll metabolism
mtul01100  Metabolic pathways
mtul01110  Biosynthesis of secondary metabolites
mtul01120  Microbial metabolism in diverse environments
Module
mtul_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mtul00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TBHG_00523
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtul01007]
    TBHG_00523
Enzymes [BR:mtul01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     TBHG_00523
Amino acid related enzymes [BR:mtul01007]
 Aminotransferase (transaminase)
  Class III
   TBHG_00523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: EBA41045
Position
619206..620594
Genome map
AA seq 462 aa AA seqDB search
MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLID
ADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTPAETQLAGEIIGRVAPV
ERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALLADAGSGVATLGLCDDP
QRPASPRSQSSRGLPSSPGVTGAAAADTIVLPYNDIDAVQQTFARFGEQIAAVITEASPG
NMGVVPPGPGFNAALRAITAEHGALLILDEVMTGFRVSRSGWYGIDPVPADLFAFGKVMS
GGMPAAAFGGRAEVMQRLAPLGPVYQAGTLSGNPVAVAAGLATLRAADDAVYTALDANAD
RLAGLLSEALTDAVVPHQISRAGNMLSVFFGETPVTDFASARASQTWRYPAFFHAMLDAG
VYPPCSAFEAWFVSAALDDAAFGRIANALPAAARAAAQERPA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcacggaacaggccacctcgcgggtaaggggagccgcgcgcacatcggcgcag
ctgttcgaggccgcatgcagcgtcatacccggcggagtgaactccccggtgcgggcgttc
acggcggtgggcggcaccccgcgcttcattaccgaagcccacggctgctggttgattgac
gccgacggcaaccgctacgtagacctggtctgctcatggggcccgatgatcctcggtcac
gcgcatccggccgtcgtcgaggcagtggccaaggccgcagcccgcggcctgtccttcggg
gccccgactcccgccgaaacccaactagccggcgagatcatcggccgggtagctcccgtc
gagcggatacggctggtgaactccggcaccgaggccactatgagcgccgtgcggctggcc
cgcggattcaccggccgggccaagatcgtcaagttctccggctgctaccacggacacgtc
gacgcattgctcgccgacgcgggttcgggagtggccaccctgggcttatgtgacgacccc
cagcgcccggcttcgccgcgctcgcaatcgtcacggggcctgccgtcctcccccggggtc
actggcgccgcggcagccgacacgatcgtgttgccctacaacgacatcgatgccgtacag
cagaccttcgcccggttcggcgagcagatcgccgccgtaatcaccgaggccagccccggc
aacatgggagtcgtcccgcccgggcccggcttcaacgcggcgctgcgcgcgatcaccgcc
gagcacggcgccctgctcatcctcgacgaggtgatgaccgggttccgggtcagccgaagt
ggttggtacggaatcgatccggtgcccgctgacctgttcgccttcggcaaggtgatgagc
ggcgggatgcccgccgccgcgttcggcgggcgcgccgaggtgatgcagcggctggcgccg
ctggggccggtgtatcaggccggcacgttgtcgggtaacccggtggcggttgccgccggg
ctggcaacgctgcgggccgccgacgacgcggtctacaccgcattggacgccaacgctgac
cgcctggccggcctgctctccgaggcactgacggatgccgttgtgccacaccagatttcg
cgggcaggcaatatgctcagtgtgttcttcggcgaaacaccggtgaccgacttcgcgtcc
gcgcgggccagccagacctggcgttatccagcgttctttcatgccatgctggacgccggt
gtctacccgccgtgcagtgccttcgaggcatggttcgtctcggccgctttggacgacgcg
gcgttcggccggatcgccaacgcgctgcccgccgcggcccgagcggcggcccaggaaagg
cccgcctga

DBGET integrated database retrieval system