KEGG   Mycobacterium tuberculosis Haarlem: TBHG_02386Help
Entry
TBHG_02386        CDS       T02845                                 

Definition
(GenBank) nucleoside diphosphate kinase NdkA
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00230  Purine metabolism
mtul00240  Pyrimidine metabolism
mtul00983  Drug metabolism - other enzymes
mtul01100  Metabolic pathways
mtul01110  Biosynthesis of secondary metabolites
mtul01130  Biosynthesis of antibiotics
Module
mtul_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mtul_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mtul_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mtul00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TBHG_02386
   00240 Pyrimidine metabolism
    TBHG_02386
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    TBHG_02386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mtul04131]
    TBHG_02386
Enzymes [BR:mtul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     TBHG_02386
Membrane trafficking [BR:mtul04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    TBHG_02386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK TruB_C
Motif
Other DBs
NCBI-ProteinID: EBA42781
Structure
PDB: 

Position
complement(2741280..2741690)
Genome map
AA seq 136 aa AA seqDB search
MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFG
SLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSD
SAESAQREIALWFPGA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacggactctggtactgatcaagccggatggcatcgaaaggcagctgatcggc
gagatcatcagccgcatcgagcgcaaaggcctcaccatcgctgcgctgcagctcaggacc
gtcagcgcggagttggccagccagcactacgccgaacatgaaggcaaaccattctttgga
tcgttgctggagttcatcacgtcgggtccggtggtagcggcgatcgtggagggaacccga
gccatcgcggcggttcgccaactcgccggcggcaccgacccggtgcaggcggcggcgccc
ggcacaatccggggcgacttcgctctagagacgcagttcaacctggtgcacgggtctgat
tcggccgaatccgcgcagcgcgaaatcgcgctctggtttcccggcgcctag

DBGET integrated database retrieval system