KEGG   Mycobacterium tuberculosis Haarlem: TBHG_02782Help
Entry
TBHG_02782        CDS       T02845                                 

Definition
(GenBank) malate dehydrogenase Mqo
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00020  Citrate cycle (TCA cycle)
mtul00620  Pyruvate metabolism
mtul01100  Metabolic pathways
mtul01110  Biosynthesis of secondary metabolites
mtul01120  Microbial metabolism in diverse environments
mtul01130  Biosynthesis of antibiotics
mtul01200  Carbon metabolism
Module
mtul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TBHG_02782
   00620 Pyruvate metabolism
    TBHG_02782
Enzymes [BR:mtul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     TBHG_02782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGV30844
Position
complement(3156085..3157566)
Genome map
AA seq 493 aa AA seqDB search
MSDLARTDVVLIGAGIMSATLGVLLRRLEPNWSITLIERLDAVAAESSGPWNNAGTGHSA
LCEMNYTPEMPDGSIDITKAVRVNEQFQVTRQFWAYAAENGILTDVRSFLNPVPHVSFVH
GSRGVEYLRRRQKALAGNPLFAGTEFIESPDEFARRLPFMAAKRAFSEPVALNWAADGTD
VDFGALAKQLIGYCVQNGTTALFGHEVRNLSRQSDGSWTVTMCNRRTGEKRKLNTKFVFV
GAGGDTLPVLQKSGIKEVKGFAGFPIGGRFLRAGNPALTASHRAKVYGFPAPGAPPLGAL
HLDLRFVNGKSWLVFGPYAGWSPKFLKHGQISDLPRSIRPDNLLSVLGVGLTERRLLNYL
ISQLRLSEPERVSALREFAPSAIDSDWELTIAGQRVQVIRRDERNGGVLEFGTTVIGDAD
GSIAGLLGGSPGASTAVAIMLDVLQKCFANRYQSWLPTLKEMVPSLGVQLSNEPALFDEV
WSWSTKALKLGAA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagacctagccagaaccgacgtcgtgctgatcggtgcgggcatcatgagcgccacg
ctgggggtgctgctgcgtcggctcgaaccgaactggtcaatcaccctgatcgaacggctg
gacgcggtagccgccgaaagcagcggtccctggaacaacgccggcaccgggcactccgcg
ctgtgcgagatgaactacaccccagaaatgccggacggctcgatcgacatcaccaaagcg
gtgcgtgtcaacgagcaattccaggtcacccgccagttctgggcatacgcggccgaaaac
ggcatcctcaccgacgtgcgcagcttcctcaaccctgtgccgcacgtgagtttcgtccat
ggatcgcggggcgtcgagtatctacggcgccgccaaaaggcgttggccggcaacccgctg
ttcgccggcaccgagttcatcgagagtcccgacgaattcgcccgccggctgccgttcatg
gccgctaaacgggccttctccgagccggtggcgctcaactgggccgccgacggcaccgac
gtcgacttcggtgccctcgccaaacaactcatcggctattgcgtgcaaaatggcactacc
gcgttgttcgggcacgaggttcgcaacctctcgcggcaatccgacggcagctggacggtc
accatgtgcaaccgccggaccggcgaaaagcgcaagttgaacaccaagttcgtctttgtc
ggggccgggggtgacaccttgccggtgctgcagaaatccgggatcaaagaggtcaaaggc
ttcgccggcttcccgattggcggtcggttcctgcgcgccgggaacccggcgctcaccgcc
tcgcatcgggcaaaggtatatggcttcccggcgccgggcgccccgccgttgggcgccttg
catctggatctgcggtttgtcaacggcaagtcgtggctggtgttcgggccatacgccggc
tggtcgccgaagttcttgaaacacgggcagatcagcgacctgccccggtcgatcaggccg
gacaatctgttgtccgtgctcggcgtgggcctcaccgagcggagactgctgaactacttg
atcagccagctgcgtctctctgaacccgagcgggtcagtgcgctgcgcgaattcgcccct
agcgcaatcgattcggactgggagttgacgatagccggtcagcgggtacaggtgatccgg
cgagatgaacgcaacggcggggtgctcgagttcggcacgacggtcatcggcgatgctgac
ggtagtattgccggactactgggcggctccccaggggcttcgaccgcggtggcgatcatg
ctggacgtgctgcagaaatgctttgccaaccgctatcaatcctggctgcccacgctcaaa
gaaatggtgccgtcgctgggggtgcagctgtcgaatgaacccgcgctgttcgacgaggtg
tggtcatggagcaccaaggcgctgaagttaggtgccgcatga

DBGET integrated database retrieval system