KEGG   Mycobacterium tuberculosis Haarlem: TBHG_03102Help
Entry
TBHG_03102        CDS       T02845                                 

Definition
(GenBank) flavin-containing monoamine oxidase AofH
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00260  Glycine, serine and threonine metabolism
mtul00330  Arginine and proline metabolism
mtul00340  Histidine metabolism
mtul00350  Tyrosine metabolism
mtul00360  Phenylalanine metabolism
mtul00380  Tryptophan metabolism
mtul01100  Metabolic pathways
mtul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtul00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TBHG_03102
   00330 Arginine and proline metabolism
    TBHG_03102
   00340 Histidine metabolism
    TBHG_03102
   00350 Tyrosine metabolism
    TBHG_03102
   00360 Phenylalanine metabolism
    TBHG_03102
   00380 Tryptophan metabolism
    TBHG_03102
Enzymes [BR:mtul01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     TBHG_03102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 FAD_binding_2 Pyr_redox FAD_oxidored Thi4 Pyr_redox_3 HI0933_like FAD_binding_3 GIDA Lycopene_cycl NAD_binding_9 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: EBA43353
Position
3534042..3535406
Genome map
AA seq 454 aa AA seqDB search
MRLTRAVTNPPWTVDVVVVGAGFAGLAAARELTRQGHEVLVFEGRDRVGGRSLTGRVAGV
PADMGGSFIGPTQDAVLALATELGIPTTPTHRDGRNVIQWRGSARSYRGTIPKLSLTGLI
DIGRLRWQFERIARGVPVAAPWDARRARELDDVSLGEWLRLVRATSSSRNLMAIMTRVTW
GCEPDDVSMLHAARYVRAAGGLDRLLDVKNGAQQDRVPGGTQQIAQAAAAQLGARVLLNA
AVRRIDRHGAGVTVTSDQGQAEAGFVIVAIPPAHRVAIEFDPPLPPEYQQLAHHWPQGRL
SKAYAAYSTPFWRASGYSGQALSDEAPVFITFDVSPHADGPGILMGFVDARGFDSLPIEE
RRRDALRCFASLFGDEALDPLDYVDYRWGTEEFAPGGPTAAVPPGSWTKYGHWLREPVGP
IHWASTETADEWTGYFDGAVRSGQRAAAEVAALL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgactagagcggtgacaaacccaccgtggactgtcgatgttgtcgtggtgggc
gcgggcttcgccgggctggccgcggcccgcgagctgacgcgacagggtcacgaggtgctg
gtgttcgaaggccgcgatcgggtgggcggccgctcgttaaccggtcgcgtggcaggggtg
cccgcggatatgggcggctcgttcatcggcccgacccaagacgccgtgctggcgttggcc
accgagctggggatcccgacaaccccgacccaccgcgacggccgaaacgtcatccagtgg
cggggatcggcacgcagctatcgtggcaccatccccaagctgtcgctgaccgggctcatc
gacatcggccggttgcgttggcaattcgagcgaattgcccgcggcgttccggtggccgcc
ccctgggatgcgcggcgcgcgcgtgaactcgacgacgtgtcgctcggggagtggttgcgc
ttggtgcgcgccacatcgtcctcgcggaacctgatggccatcatgacccgggtgacctgg
ggttgtgagcccgacgatgtctcgatgctgcacgccgcccgctacgtacgcgcggccggc
ggcctggaccggctgctcgacgtcaaaaatggtgcccagcaggaccgtgtgccggggggg
acacagcagatcgcccaggcggccgccgcccaactcggcgcacgcgtcctgctcaacgcc
gcggtgcgtcgcatcgaccggcacggagcgggtgtgacggtcacgtccgatcagggtcag
gccgaggccgggttcgtcatcgtcgccattccaccggcccatcgcgtggccatcgagttc
gatcccccgctgccgccggaatatcagcagctcgcccaccattggccgcagggccggctg
agcaaggcctacgcggcctattcgacgccgttctggcgggccagcgggtattccggccag
gcgctgtccgatgaggcgccggtgttcatcaccttcgacgtcagtccgcacgccgacggg
ccaggcattctgatggggttcgtcgatgctcgcgggttcgactcgctacccatcgaagag
cgccgccgcgatgcattgcgctgctttgcgtcgctgttcggcgacgaagcgctcgacccc
cttgattatgttgactatcgttggggtacagaggaattcgcgccgggtggtccgaccgcg
gcggtaccgccggggtcgtggacgaaatacggtcactggttacgtgagccggtcggtccg
attcactgggcgagcactgagaccgcggacgaatggaccgggtatttcgacggcgccgtc
agatccggtcagcgtgccgccgccgaggtcgccgccctgctatga

DBGET integrated database retrieval system