KEGG   Mycobacterium tuberculosis Haarlem: TBHG_03251Help
Entry
TBHG_03251        CDS       T02845                                 

Definition
(GenBank) thymidine phosphorylase DeoA
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00240  Pyrimidine metabolism
mtul00983  Drug metabolism - other enzymes
mtul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtul00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TBHG_03251
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    TBHG_03251
Enzymes [BR:mtul01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     TBHG_03251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: EBA43494
Position
complement(3695017..3696300)
Genome map
AA seq 427 aa AA seqDB search
MTDFAFDAPTVIRTKRDGGRLSDAAIDWVVKAYTDGRVADEQMSALLMAIVWRGMDRGEI
ARWTAAMLASGARLDFTDLPLATVDKHSTGGVGDKITLPLVPVVAACGGAVPQASGRGLG
HTGGTLDKLESITGFTANLSNQRVREQLCDVGAAIFAAGQLAPADAKLYALRDITGTVES
LPLIASSIMSKKLAEGAGALVLDVKVGSGAFMRSPVQARELAHTMVELGAAHGVPTRALL
TEMNCPLGRTVGNALEVAEALEVLAGGGPPDVVELTLRLAGEMLELAGIHGRDPAQTLRD
GTAMDRFRRLVAAQGGDLSKPLPIGSHSETVTAGASGTMGDIDAMAVGLAAWRLGAGRSR
PGARVQHGAGVRIHRRPGEPVVVGEPLFTLYTNAPERFGAARAELAGGWSIRDSPPQVRP
LIVDRIV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacttcgcattcgacgccccgaccgtcatccgcaccaaacgtgacggcggccgg
ttgtccgacgccgccatcgactgggtcgtcaaggcctataccgacggccgggtcgccgac
gaacagatgtcggcgctgctgatggcgatcgtttggcggggcatggaccgcggcgagatc
gccagatggacggcggccatgctggcctcgggtgcccggctggatttcaccgatctgcca
ctagcgaccgtggacaagcattccaccggcggggtaggtgacaaaatcacgctgccattg
gtgcccgtcgtcgccgcctgcggtggcgcagtgccccaggcgtcgggccgcggactcggc
cacaccggcggcaccctggacaagctggaatccatcaccgggttcaccgcgaatctgtcc
aaccagcgggtgcgcgagcagctttgcgacgtcggcgccgcgatcttcgccgccggccag
ctggcgccagccgatgccaagctgtatgcgctgcgcgacattaccggcaccgtcgaatcg
ctgccgttgatcgccagttcgattatgagcaagaagctggctgagggtgcgggtgcactg
gtgctcgacgtcaaggttggttccggggccttcatgaggtcgccagtgcaggcgcgcgaa
cttgcgcacaccatggtcgaactgggcgcggcgcatggcgtgcccacccgtgccctgctg
acggagatgaactgcccgctgggtcgaaccgtcggcaatgcgctcgaggtggccgaggcg
ctggaggtgctggccggcggcggaccgcccgacgtggtggagctgacgttgcggctggcc
ggcgagatgctcgagcttgccgggatccacggccgggacccggcccagacgctgcgggac
ggcaccgcaatggaccggtttcgccggttggttgccgcgcagggaggtgacttgtcgaaa
ccgttgccgatcggttcgcattcggaaaccgtcacggcgggcgcgagcggcacaatgggc
gacatcgatgcgatggcagtggggttagcggcatggcgactcggtgcgggcaggtcccgc
ccgggcgcacgcgtacagcacggtgcgggggtgcggattcatcgccgcccgggggagccg
gttgtggtcggtgagccgttgttcaccctctacacgaatgctcccgagcgctttggtgcg
gcgcgagccgagctggccggcggttggagtatccgggacagtccgccgcaggtgcggccg
ctaatcgtcgatcggatcgtctga

DBGET integrated database retrieval system