KEGG   Mycobacterium tuberculosis Haarlem: TBHG_03278Help
Entry
TBHG_03278        CDS       T02845                                 

Definition
(GenBank) isocitrate dehydrogenase Icd1
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00020  Citrate cycle (TCA cycle)
mtul00480  Glutathione metabolism
mtul01100  Metabolic pathways
mtul01110  Biosynthesis of secondary metabolites
mtul01120  Microbial metabolism in diverse environments
mtul01130  Biosynthesis of antibiotics
mtul01200  Carbon metabolism
mtul01210  2-Oxocarboxylic acid metabolism
mtul01230  Biosynthesis of amino acids
Module
mtul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtul_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mtul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TBHG_03278
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TBHG_03278
Enzymes [BR:mtul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     TBHG_03278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: EBA43520
Structure
PDB: 

Position
complement(3721350..3722579)
Genome map
AA seq 409 aa AA seqDB search
MSNAPKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVT
IDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNV
PRLVPGWTKPIVIGRHAFGDQYRATNFKVDQPGTVTLTFTPADGSAPIVHEMVSIPEDGG
VVLGMYNFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKA
QFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMT
ADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAH
KLESVVIATVESGKMTKDLAILIGPEQDWLNSEEFLDAIADNLEKELAN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgcacccaagataaaagtcagcggtccggtcgtagagctcgacggtgacgag
atgacccgtgtcatctggaagctcatcaaggacatgcttatccttccctatctcgacatc
cgcttggactattacgacttgggcatcgagcaccgcgacgccaccgacgaccaggtgacg
atcgacgcggcgtatgcgatcaagaaacacggtgtgggcgtaaagtgcgcgacgatcacc
cccgacgaggcccgtgtcgaggaattcaacctgaagaagatgtggctgtcgcccaatggg
acaatccggaacatcttgggcggcacaatctttcgcgaacctatcgtgatttctaatgtg
ccgcgactggttccggggtggaccaagccgatcgtcatcggccggcacgcttttggtgac
caatatcgggcgacgaacttcaaggtcgaccaaccgggcaccgtcacactgactttcacg
cccgccgacggcagcgcgccgatcgtgcacgaaatggtgtccatccccgaggacggcggc
gtcgtgctggggatgtacaacttcaaggaatccatccgggatttcgcgcgcgcgtcgttc
tcctacggcctcaacgcgaaatggccggtatatctgtccaccaagaacaccatcctcaag
gcctacgacgggatgttcaaagacgagttcgagcgcgtctacgaagaggaattcaaggcg
cagttcgaagcggcggggctgacctacgagcatcggttgatcgacgacatggtcgccgcc
tgcctgaaatgggaaggcggttacgtctgggcgtgcaagaactacgacggcgacgtgcag
tcggacaccgtcgcacagggctacggctcgctgggcctgatgacgtcggtgctgatgacg
gccgacggcaagacagtcgaggccgaagccgcccacggcaccgtcacccggcattaccgg
cagtatcaggccggtaaaccgacctcaacaaacccgatcgcgtcgatctttgcctggacc
cgcggattacagcatcgcggcaagctggatggcactcccgaagtcatcgacttcgcccac
aagctggagtccgtcgtcatcgccacggtggagagcgggaagatgaccaaggacctcgcg
atcctcatcggtccggagcaggactggctgaatagcgaggaattcctcgatgcgatcgcc
gacaacctggaaaaggagctggccaattag

DBGET integrated database retrieval system