KEGG   Mycobacterium tuberculosis Haarlem: TBHG_03280Help
Entry
TBHG_03280        CDS       T02845                                 

Definition
(GenBank) homoserine O-acetyltransferase MetA
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00270  Cysteine and methionine metabolism
mtul00920  Sulfur metabolism
mtul01100  Metabolic pathways
mtul01110  Biosynthesis of secondary metabolites
mtul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtul00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    TBHG_03280
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TBHG_03280
Enzymes [BR:mtul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     TBHG_03280
    2.3.1.46  homoserine O-succinyltransferase
     TBHG_03280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 DUF4884
Motif
Other DBs
NCBI-ProteinID: EBA43522
Position
3724223..3725362
Genome map
AA seq 379 aa AA seqDB search
MTISDVPTQTLPAEGEIGLIDVGSLQLESGAVIDDVCIAVQRWGKLSPARDNVVVVLHAL
TGDSHITGPAGPGHPTPGWWDGVAGPGAPIDTTRWCAVATNVLGGCRGSTGPSSLARDGK
PWGSRFPLISIRDQVQADVAALAALGITEVAAVVGGSMGGARALEWVVGYPDRVRAGLLL
AVGARATADQIGTQTTQIAAIKADPDWQSGDYHETGRAPDAGLRLARRFAHLTYRGEIEL
DTRFANHNQGNEDPTAGGRYAVQSYLEHQGDKLLSRFDAGSYVILTEALNSHDVGRGRGG
VSAALRACPVPVVVGGITSDRLYPLRLQQELADLLPGCAGLRVVESVYGHDGFLVETEAV
GELIRQTLGLADREGACRR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctccgatgtacccacccagacgctgcccgccgaaggcgaaatcggcctgata
gacgtcggctcgctgcaactggaaagcggggcggtgatcgacgatgtctgtatcgccgtg
caacgctggggcaaattgtcgcccgcacgggacaacgtggtggtggtcttgcacgcgctc
accggcgactcgcacatcactggacccgccggacccggccaccccacccccggctggtgg
gacggggtggccgggccgggtgcgccgattgacaccacccgctggtgcgcggtagctacc
aatgtgctcggcggctgccgcggctccaccgggcccagctcgcttgcccgcgacggaaag
ccttggggctcaagatttccgctgatctcgatacgtgaccaggtgcaggcggacgtcgcg
gcgctggccgcgctgggcatcaccgaggtcgccgccgtcgtcggcggctccatgggcggc
gcccgggccctggaatgggtggtcggctacccggatcgggtccgagccggattgctgctg
gcggtcggtgcgcgtgccaccgcagaccagatcggcacgcagacaacgcaaatcgcggcc
atcaaagccgacccggactggcagagcggcgactaccacgagacggggagggcaccagac
gccgggctgcgactcgcccgccgcttcgcgcacctcacctaccgcggcgagatcgagctc
gacacccggttcgccaaccacaaccagggcaacgaggatccgacggccggcgggcgctac
gcggtgcaaagttatctggaacaccaaggagacaaactgttatcccggttcgacgccggc
agctacgtgattctcaccgaggcgctcaacagccacgacgtcggccgcggccgcggcggg
gtctccgcggctctgcgcgcctgcccggtgccggtggtggtgggcggcatcacctccgac
cggctctacccgctgcgcctgcagcaggagctggccgacctgctgccgggctgcgccggg
ctgcgagtcgtcgagtcggtctacggacacgacggcttcctggtggaaaccgaggccgtg
ggcgaattgatccgccagacactgggattggctgatcgtgaaggcgcgtgtcggcggtga

DBGET integrated database retrieval system