KEGG   Methylocella tundrae: MTUNDRAET4_2741Help
Entry
MTUNDRAET4_2741   CDS       T05970                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mtun  Methylocella tundrae
Pathway
mtun00790  Folate biosynthesis
mtun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MTUNDRAET4_2741
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtun04147]
    MTUNDRAET4_2741
Enzymes [BR:mtun01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     MTUNDRAET4_2741
Exosome [BR:mtun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MTUNDRAET4_2741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a MAP
Motif
Other DBs
NCBI-ProteinID: VFU09628
UniProt: A0A4U8Z2R9
Position
1:complement(2477540..2477986)
Genome map
AA seq 148 aa AA seqDB search
MRMIAAAEAARNWLLTIGESAVTDDKKERTYSDEEVEARLKSELPHWRLEDGWIRRKYKT
HSWKGTLMVINTVGHLAEAAWHHPDITASYAWVEVRLKNHNARGITDKDFELAKKIEEVV
SWQPGKAGGALEGTPEKDPRFAYLKYED
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgatcgccgcggccgaggcggcgcggaattggctgctgaccattggagaatcc
gccgtgacggatgacaaaaaagaacgcacctattcggatgaggaagtcgaagccaggctg
aagagcgaattgccgcattggcgcctggaggacggctggatccgccgtaaatacaagacg
catagctggaagggcacgctgatggtgatcaatacggtcggccatcttgcggaagcagcc
tggcaccatccggacattaccgcctcttacgcctgggtcgaggtgaggctcaagaatcac
aatgcgagaggcatcaccgacaaggactttgaattggcgaaaaagatcgaggaagtggtg
tcctggcagccggggaaagccggcggcgcgctcgaaggaacgccggagaaagacccgcgc
ttcgcctatttgaaatatgaagattaa

DBGET integrated database retrieval system