KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_0569Help
Entry
CFBS_0569         CDS       T02679                                 

Definition
(GenBank) hypothetical protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mtur  Mycobacterium tuberculosis CCDC5079
Brite
KEGG Orthology (KO) [BR:mtur00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CFBS_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGL99001
Position
complement(634605..635858)
Genome map
AA seq 417 aa AA seqDB search
MNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVAVALSAVLNLIGAFLS
TAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLGIPSSSSHALIGGIVGATIAA
VGLRGVIWSGVVSKVIVPAVVAALLATLVGAVGTWLVYRTTRGVAEKRTERGFRRGQIGS
ASLVSLAHGTNDAQKTMGVIFLALMSYGAVSTTASVPPLWVIVSCAVAMAAGTYLGGWRI
IRTLGKGLVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQVATGSVLGSGVGKPGAEVR
WGVAGRMVVAWLVTLPLAGLVGAFTYGLVHFIGGYPGAILGFALLWLTATAIWLRSRRAP
IDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPTPPPNHRAPQFGVTTRNAP
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccttcagttgttccttttgctcattgtcgtcgtgacggcattggcgttcgacttc
accaacgggttccacgacaccggaaacgccatggcgacctcgattgccagcggcgccctg
gcaccgcgggtagcggtagcactttctgccgtgctgaacctgatcggtgcgtttttgtcc
accgccgtggcggccacaatcgccaagggtctgatcgacgcgaatctggtgacgctggag
ttggtgttcgccggcctggtcggcgggatcgtctggaacctgttgacctggttgctgggc
attccgtcgagttcctcacatgcgctgatcggcggcatcgtcggcgccacaattgccgcc
gtcggcctgcgtggggtgatctggagcggagtggtgtccaaggtgatcgtgccggccgtg
gtagccgcgctgctggccacgctggtcggagcagtcggcacctggctggtctaccggacg
acgcgcggggttgccgaaaagcgtacggaacgcggtttccggcgcggccagatcggctcg
gcgtcgctggtctcgctggcgcacggcaccaacgacgcgcagaagacgatgggcgtgatc
ttcctggcgttgatgtcctacggcgcggtcagcacgacggcatcggtgccgccgctgtgg
gtgatcgtgagttgcgccgtggccatggccgccggtacctacctgggtggctggcgcatc
atccgcaccctaggcaaagggctggtcgagatcaaaccaccgcagggtatggccgccgag
tcgtcatcggccgccgtcattctgttgtccgcgcacttcggctatgcgctgtccacaacg
caggtcgcgaccgggtccgtgctgggcagcggcgtcggcaagcccggcgccgaggtgcgc
tggggggtagccggccgcatggtggtcgcgtggctggtgacgctcccgttggccgggctg
gtcggggccttcacctacgggctggtgcatttcatcggtggctaccccggtgcgatcctc
ggtttcgcactgttgtggctgaccgccaccgccatctggctgcggtcgcgcagggcgccg
atcgaccacaccaacgtcaacgccgactgggaaggcaacctgacggccggcctggaagcg
ggtgcgcagccgcttgcggatcagaggccgccggtgcctgcaccgccggctccgactccc
ccaccgaaccaccgagcaccacagttcggcgtcaccacgaggaacgccccgtga

DBGET integrated database retrieval system